BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10g07 (786 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 25 2.0 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 25 3.5 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 25.4 bits (53), Expect = 2.0 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +1 Query: 25 ENHTDIIFFEHERYSDLNVSIQLSIKCSCVAFLAVQITY 141 E + DIIF R L ++ L I C ++FL+V + Y Sbjct: 224 EPYPDIIFNITLRRKTLFYTVNLIIPCVGISFLSVLVFY 262 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 24.6 bits (51), Expect = 3.5 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 494 HPH*ELLRNEPYLKLTHHQ 438 HPH L+ L +THHQ Sbjct: 721 HPHDLLIEENNMLNMTHHQ 739 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 808,515 Number of Sequences: 2352 Number of extensions: 16699 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82328994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -