BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10g07 (786 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC031046-1|AAH31046.1| 495|Homo sapiens meiosis-specific nuclea... 31 4.7 >BC031046-1|AAH31046.1| 495|Homo sapiens meiosis-specific nuclear structural 1 protein. Length = 495 Score = 31.1 bits (67), Expect = 4.7 Identities = 19/83 (22%), Positives = 45/83 (54%), Gaps = 2/83 (2%) Frame = +2 Query: 143 K*ENNYYIMVHDVILLQVPLPKLEELQKTIFSSEVLEFIAALHRNFDE--KIELLYENRK 316 K + Y ++ + +++ + K+ E + + + LE + A+ R+ +E K + L+ +K Sbjct: 201 KKQEAYEQLLKEKLMIDEIVRKIYE-EDQLEKQQKLEKMNAMRRHIEEFQKEQALWRKKK 259 Query: 317 RRAVEIKNDPFIDFKNSPERRDK 385 R +E +N I+F N ++R++ Sbjct: 260 REEMEEENRKIIEFANMQQQREE 282 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,227,085 Number of Sequences: 237096 Number of extensions: 2169949 Number of successful extensions: 3844 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3836 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9590293096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -