BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10g05 (694 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032631-5|CAA21573.1| 113|Caenorhabditis elegans Hypothetical ... 89 4e-18 L17337-6|AAA28221.2| 44|Caenorhabditis elegans Hypothetical pr... 32 0.45 Z82277-3|CAB05249.2| 495|Caenorhabditis elegans Hypothetical pr... 30 1.8 AC006816-1|AAN39661.1| 401|Caenorhabditis elegans Hypothetical ... 30 1.8 AB071420-1|BAB86940.1| 401|Caenorhabditis elegans 2-amino-3-car... 30 1.8 Z81098-1|CAB03183.1| 581|Caenorhabditis elegans Hypothetical pr... 27 9.6 >AL032631-5|CAA21573.1| 113|Caenorhabditis elegans Hypothetical protein Y106G6H.3 protein. Length = 113 Score = 88.6 bits (210), Expect = 4e-18 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +1 Query: 565 RKSEIEYYALLAKTGVHHYSGNNIELGTACGKYYRVCTLAITD 693 RKSEIEYYA+LAKTGVHHY+GNNIELGTACG+ +RVCTLA+TD Sbjct: 56 RKSEIEYYAMLAKTGVHHYNGNNIELGTACGRLFRVCTLAVTD 98 Score = 80.2 bits (189), Expect = 1e-15 Identities = 38/56 (67%), Positives = 45/56 (80%) Frame = +2 Query: 74 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPPLR 241 M A K +K E+INSRL++VMK+G+Y LGYKQTLK+L GKAKLVIIA N PPLR Sbjct: 1 MAPAAKPQKNAENINSRLSMVMKTGQYVLGYKQTLKSLLNGKAKLVIIANNTPPLR 56 >L17337-6|AAA28221.2| 44|Caenorhabditis elegans Hypothetical protein ZK686.1 protein. Length = 44 Score = 31.9 bits (69), Expect = 0.45 Identities = 17/32 (53%), Positives = 23/32 (71%) Frame = +2 Query: 131 LVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKN 226 +VMK+G+Y L Y+Q LK+L AKLVI K+ Sbjct: 1 MVMKTGQYVL-YEQKLKSLLNENAKLVINTKH 31 >Z82277-3|CAB05249.2| 495|Caenorhabditis elegans Hypothetical protein LLC1.3 protein. Length = 495 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +2 Query: 47 GFISIYAPKMVAAKKQKKTIESINSRLALV 136 GF +I P V AKK ++E+IN+R L+ Sbjct: 138 GFATIVGPNTVQAKKNDGSVETINARNILI 167 >AC006816-1|AAN39661.1| 401|Caenorhabditis elegans Hypothetical protein Y71D11A.3b protein. Length = 401 Score = 29.9 bits (64), Expect = 1.8 Identities = 21/43 (48%), Positives = 26/43 (60%), Gaps = 6/43 (13%) Frame = -3 Query: 374 LSSI*PYFCELFY*---TTK--GIHTSLSVRLHMHPFDKY-WE 264 LS+I P FCE F TTK GI LSV L +HP+D + W+ Sbjct: 200 LSTIMPGFCEFFENWGLTTKTPGICEELSVVLFVHPWDMHMWD 242 >AB071420-1|BAB86940.1| 401|Caenorhabditis elegans 2-amino-3-carboxylmuconate-6-semialdehydedecarboxylase protein. Length = 401 Score = 29.9 bits (64), Expect = 1.8 Identities = 21/43 (48%), Positives = 26/43 (60%), Gaps = 6/43 (13%) Frame = -3 Query: 374 LSSI*PYFCELFY*---TTK--GIHTSLSVRLHMHPFDKY-WE 264 LS+I P FCE F TTK GI LSV L +HP+D + W+ Sbjct: 200 LSTIMPGFCEFFENWGLTTKTPGICEELSVVLFVHPWDMHMWD 242 >Z81098-1|CAB03183.1| 581|Caenorhabditis elegans Hypothetical protein K07A12.1 protein. Length = 581 Score = 27.5 bits (58), Expect = 9.6 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 504 CWITMWGTYGVVFKLD 551 CW T W T ++FKLD Sbjct: 244 CWETAWNTAKMIFKLD 259 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,959,223 Number of Sequences: 27780 Number of extensions: 319727 Number of successful extensions: 629 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 612 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 629 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1592382278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -