BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10g04 (683 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 25 0.51 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 25 0.67 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 25 0.67 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 25 0.67 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 25 0.67 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 25 0.89 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 24 1.2 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 24 1.2 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 24 1.2 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 24 1.2 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 24 1.6 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 23 2.1 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 23 2.1 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 23 2.1 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 23 2.7 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 4.7 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 4.7 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 4.7 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 4.7 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 6.3 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 6.3 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 22 6.3 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 6.3 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 8.3 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 21 8.3 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 8.3 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 8.3 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.4 bits (53), Expect = 0.51 Identities = 21/95 (22%), Positives = 42/95 (44%) Frame = +3 Query: 339 RIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQ 518 +I +++Q+ VL V ++ K + SLR + Q + + S + + + Sbjct: 185 KINKIEEQDTVLVVNIEKSGKESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNRE 244 Query: 519 ALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 KK+++ H E+ E+ L SRK +E+ Sbjct: 245 YRKKDRQYEKLHNEK-EKLLEERTSRKRYSRSRER 278 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.0 bits (52), Expect = 0.67 Identities = 15/71 (21%), Positives = 36/71 (50%) Frame = +3 Query: 417 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSR 596 ++ NR R+ + ++E+++ +K + +E+E ++ ERE + SR Sbjct: 6 RDRNREYRKKDRQYEKLYNEKEKFLEEKTSRKRYSRSREREQKSYKNEREYR-EYRETSR 64 Query: 597 KLNQLRQEKCR 629 + ++ R+E+ R Sbjct: 65 ERSRDRKERER 75 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.0 bits (52), Expect = 0.67 Identities = 15/71 (21%), Positives = 36/71 (50%) Frame = +3 Query: 417 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSR 596 ++ NR R+ + ++E+++ +K + +E+E ++ ERE + SR Sbjct: 6 RDRNREYRKKDRQYEKLYNEKEKFLEEKTSRKRYSRSREREQKSYKNEREYR-EYRETSR 64 Query: 597 KLNQLRQEKCR 629 + ++ R+E+ R Sbjct: 65 ERSRDRKERER 75 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.0 bits (52), Expect = 0.67 Identities = 15/71 (21%), Positives = 36/71 (50%) Frame = +3 Query: 417 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSR 596 ++ NR R+ + ++E+++ +K + +E+E ++ ERE + SR Sbjct: 6 RDRNREYRKKDRQYEKLYNEKEKFLEEKTSRKRYSRSREREQKSYKNEREYR-EYRETSR 64 Query: 597 KLNQLRQEKCR 629 + ++ R+E+ R Sbjct: 65 ERSRDRKERER 75 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.0 bits (52), Expect = 0.67 Identities = 15/71 (21%), Positives = 36/71 (50%) Frame = +3 Query: 417 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSR 596 ++ NR R+ + ++E+++ +K + +E+E ++ ERE + SR Sbjct: 6 RDRNREYRKKDRQYEKLYNEKEKFLEEKTSRKRYSRSREREQKSYKNEREYR-EYRETSR 64 Query: 597 KLNQLRQEKCR 629 + ++ R+E+ R Sbjct: 65 ERSRDRKERER 75 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 24.6 bits (51), Expect = 0.89 Identities = 32/130 (24%), Positives = 53/130 (40%), Gaps = 7/130 (5%) Frame = -3 Query: 429 GFLLAKLSHEVCKYLTPLSKLYFVAVEIQFFSVVDHE-KQYS----EEALRHRQVNWSHF 265 G L K+ V + + +S L VA ++ + + H + Y+ + +R W Sbjct: 110 GVSLCKIRAYVSEMSSYVSVLTIVAFSMERYLAICHPLRVYTISGLKRPIRFILAAWLIA 169 Query: 264 RTPNLPF--YDLVKLQNHPFARVTRTATKCQNSDLTINENYIFLREITIVFFLVISSTIT 91 +PF Y V L +P +A + LTI ++ TI+FFL I I Sbjct: 170 LISAIPFAIYTKVNLVEYPPESGNYSADSAMCAMLTIYADFPLYELSTIIFFL-IPMLII 228 Query: 90 IKSLTRNSVK 61 + TR +K Sbjct: 229 LVVYTRMGLK 238 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/50 (22%), Positives = 24/50 (48%) Frame = +3 Query: 417 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYERE 566 ++ NR R+ + +EE+ + +K + +E+E ++ ERE Sbjct: 6 RDRNREYRKKDRQYEKLCNEEEKLLEERTSRKRYSRSREREQNSYKNERE 55 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/50 (22%), Positives = 24/50 (48%) Frame = +3 Query: 417 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYERE 566 ++ NR R+ + +EE+ + +K + +E+E ++ ERE Sbjct: 6 RDRNREYRKKDRQYEKLCNEEEKLLEERTSRKRYSRSREREQNSYKNERE 55 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/50 (22%), Positives = 24/50 (48%) Frame = +3 Query: 417 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYERE 566 ++ NR R+ + +EE+ + +K + +E+E ++ ERE Sbjct: 6 RDRNREYRKKDRQYEKLCNEEEKLLEERTSRKRYSRSREREQNSYKNERE 55 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/50 (22%), Positives = 24/50 (48%) Frame = +3 Query: 417 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYERE 566 ++ NR R+ + +EE+ + +K + +E+E ++ ERE Sbjct: 6 RDRNREYRKKDRQYEKLCNEEEKLLEERTSRKRYSRSREREQNSYKNERE 55 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.8 bits (49), Expect = 1.6 Identities = 20/95 (21%), Positives = 42/95 (44%) Frame = +3 Query: 339 RIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQ 518 +I +++ + VL V ++ + K + SLR + Q + + S + + + Sbjct: 174 KINKIKEHDTVLVVNIEKSENESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNRE 233 Query: 519 ALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 KK+++ H E+ E+ L SRK +E+ Sbjct: 234 YRKKDRQYEKLHNEK-EKLLEERTSRKRYSRSRER 267 Score = 22.6 bits (46), Expect = 3.6 Identities = 13/73 (17%), Positives = 30/73 (41%) Frame = +3 Query: 348 SLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALK 527 SL+ + + Y ++ NR R+ + ++E+ + +K + Sbjct: 205 SLRNRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSRS 264 Query: 528 KEKETLAHHYERE 566 +E+E ++ ERE Sbjct: 265 REREQKSYKNERE 277 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.4 bits (48), Expect = 2.1 Identities = 20/95 (21%), Positives = 41/95 (43%) Frame = +3 Query: 339 RIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQ 518 +I +++ + VL V ++ K + SLR + Q + + S + + + Sbjct: 174 KINKIEEHDTVLVVNIEKSGKESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNRE 233 Query: 519 ALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 KK+++ H E+ E+ L SRK +E+ Sbjct: 234 YRKKDRQYEKLHNEK-EKLLEERTSRKRYSRSRER 267 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.4 bits (48), Expect = 2.1 Identities = 20/95 (21%), Positives = 41/95 (43%) Frame = +3 Query: 339 RIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQ 518 +I +++ + VL V ++ K + SLR + Q + + S + + + Sbjct: 185 KINKIEEHDTVLVVNIEKSGKESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNRE 244 Query: 519 ALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 KK+++ H E+ E+ L SRK +E+ Sbjct: 245 YRKKDRQYEKLHNEK-EKLLEERTSRKRYSRSRER 278 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.4 bits (48), Expect = 2.1 Identities = 20/95 (21%), Positives = 41/95 (43%) Frame = +3 Query: 339 RIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQ 518 +I +++ + VL V ++ K + SLR + Q + + S + + + Sbjct: 174 KINKIEEHDTVLVVNIEKSGKESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNRE 233 Query: 519 ALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 KK+++ H E+ E+ L SRK +E+ Sbjct: 234 YRKKDRQYEKLHNEK-EKLLEERTSRKRYSRSRER 267 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.0 bits (47), Expect = 2.7 Identities = 13/73 (17%), Positives = 30/73 (41%) Frame = +3 Query: 348 SLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALK 527 SL+ + + Y ++ NR R+ + ++E+++ K + Sbjct: 216 SLRSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSHKRYSRS 275 Query: 528 KEKETLAHHYERE 566 +E+E ++ ERE Sbjct: 276 REREQKSYKNERE 288 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 4.7 Identities = 13/73 (17%), Positives = 30/73 (41%) Frame = +3 Query: 348 SLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALK 527 SL+ + + Y ++ NR R+ + ++E+ + +K + Sbjct: 205 SLRSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSRS 264 Query: 528 KEKETLAHHYERE 566 +E+E ++ ERE Sbjct: 265 REREQNSYKNERE 277 Score = 21.8 bits (44), Expect = 6.3 Identities = 20/95 (21%), Positives = 40/95 (42%) Frame = +3 Query: 339 RIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQ 518 +I +++ + VL V + K + SLR + Q + + S + + + Sbjct: 174 KINKIEEHDTVLVVNIKKSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNRE 233 Query: 519 ALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 KK+++ H E+ E+ L SRK +E+ Sbjct: 234 YRKKDRQYEKLHNEK-EKLLEERTSRKRYSRSRER 267 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 4.7 Identities = 13/73 (17%), Positives = 30/73 (41%) Frame = +3 Query: 348 SLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALK 527 SL+ + + Y ++ NR R+ + ++E+ + +K + Sbjct: 216 SLRSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSRS 275 Query: 528 KEKETLAHHYERE 566 +E+E ++ ERE Sbjct: 276 REREQNSYKNERE 288 Score = 21.8 bits (44), Expect = 6.3 Identities = 20/95 (21%), Positives = 40/95 (42%) Frame = +3 Query: 339 RIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQ 518 +I +++ + VL V + K + SLR + Q + + S + + + Sbjct: 185 KINKIEEHDTVLVVNIKKSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNRE 244 Query: 519 ALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 KK+++ H E+ E+ L SRK +E+ Sbjct: 245 YRKKDRQYEKLHNEK-EKLLEERTSRKRYSRSRER 278 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 4.7 Identities = 20/95 (21%), Positives = 41/95 (43%) Frame = +3 Query: 339 RIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQ 518 +I +++ + VL V ++ K + SLR + Q + + S + + + Sbjct: 185 KINKIKEHDTVLVVNIEKSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNRE 244 Query: 519 ALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 KK+++ H E+ E+ L SRK +E+ Sbjct: 245 YRKKDRQYEKLHNEK-EKFLEERTSRKRYSRSRER 278 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 4.7 Identities = 20/95 (21%), Positives = 41/95 (43%) Frame = +3 Query: 339 RIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQ 518 +I +++ + VL V ++ K + SLR + Q + + S + + + Sbjct: 185 KINKIKEHDTVLVVNIEKSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNRE 244 Query: 519 ALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 KK+++ H E+ E+ L SRK +E+ Sbjct: 245 YRKKDRQYEKLHNEK-EKFLEERTSRKRYSRSRER 278 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 6.3 Identities = 13/69 (18%), Positives = 33/69 (47%) Frame = +3 Query: 417 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSR 596 ++ NR ++ + ++E+ + +K + +E+E ++ ERE + S+ Sbjct: 6 RDRNREYKEKDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNEREYR-KYRETSK 64 Query: 597 KLNQLRQEK 623 + +Q R E+ Sbjct: 65 ERSQDRTER 73 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 6.3 Identities = 13/69 (18%), Positives = 33/69 (47%) Frame = +3 Query: 417 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSR 596 ++ NR ++ + ++E+ + +K + +E+E ++ ERE + S+ Sbjct: 6 RDRNREYKEKDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNEREYR-KYRETSK 64 Query: 597 KLNQLRQEK 623 + +Q R E+ Sbjct: 65 ERSQDRTER 73 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.8 bits (44), Expect = 6.3 Identities = 20/95 (21%), Positives = 40/95 (42%) Frame = +3 Query: 339 RIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQ 518 +I +++ + VL V ++ K + SLR + Q + + S + + + Sbjct: 185 KINKIKEHDTVLVVNIEKSGNESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNRE 244 Query: 519 ALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 KK++ H E+ E+ L SRK +E+ Sbjct: 245 YRKKDRRYEKLHNEK-EKLLEERTSRKRYSRSRER 278 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.8 bits (44), Expect = 6.3 Identities = 20/95 (21%), Positives = 40/95 (42%) Frame = +3 Query: 339 RIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQ 518 +I +++ + VL V ++ K + SLR + Q + + S + + + Sbjct: 190 KINKIKEHDTVLVVNIEKSGNESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNRE 249 Query: 519 ALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 KK++ H E+ E+ L SRK +E+ Sbjct: 250 YRKKDRRYEKLHNEK-EKLLEERTSRKRYSRSRER 283 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 44 SPTNNFLTLFLVKDLIVIVLDI 109 +PTN +L V DL+ ++L + Sbjct: 66 TPTNYYLFNLAVSDLLFLILGL 87 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/50 (20%), Positives = 24/50 (48%) Frame = +3 Query: 417 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYERE 566 ++ NR R+ + ++E+ + +K + +E+E ++ ERE Sbjct: 6 RDRNREYRKKDRRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNERE 55 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/34 (23%), Positives = 17/34 (50%) Frame = +1 Query: 238 VIKWQIRRPKVTPVHLTVAQCFLRVLFLVINYRK 339 +I W R P+ + + + FL+ L ++ R+ Sbjct: 317 IINWNFRGPRTHRMPQLIRKIFLKYLPTILMMRR 350 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 8.3 Identities = 16/94 (17%), Positives = 41/94 (43%) Frame = +3 Query: 348 SLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALK 527 SL+ + + Y ++ NR ++ + ++E+ + +K + Sbjct: 205 SLRSRTHGFQHTSSRYSRERSCSRDRNREYKEKDRRYEKLHNEKEKLLEERTSRKRYSRS 264 Query: 528 KEKETLAHHYEREEECLTNDLSRKLNQLRQEKCR 629 +E+E ++ ERE + S++ ++ R+E+ R Sbjct: 265 REREQNSYKNEREYR-KYRETSKERSRDRRERER 297 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,316 Number of Sequences: 438 Number of extensions: 3573 Number of successful extensions: 46 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -