BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10g04 (683 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g18480.1 68416.m02348 CCAAT displacement protein-related / CD... 38 0.006 At3g07780.1 68416.m00949 expressed protein 37 0.011 At1g80790.1 68414.m09479 XH/XS domain-containing protein / XS zi... 36 0.019 At4g03000.2 68417.m00408 expressed protein contains similarity t... 36 0.025 At4g03000.1 68417.m00407 expressed protein contains similarity t... 36 0.025 At5g48160.1 68418.m05949 tropomyosin-related contains weak simil... 35 0.044 At3g28770.1 68416.m03591 expressed protein 35 0.044 At5g10500.1 68418.m01216 kinase interacting family protein simil... 35 0.058 At2g46270.1 68415.m05753 G-box binding factor 3 (GBF3) identical... 34 0.076 At5g52280.1 68418.m06488 protein transport protein-related low s... 34 0.10 At1g13220.2 68414.m01534 nuclear matrix constituent protein-rela... 34 0.10 At1g13220.1 68414.m01533 nuclear matrix constituent protein-rela... 34 0.10 At5g67320.1 68418.m08490 WD-40 repeat family protein strong simi... 33 0.13 At4g36730.2 68417.m05212 G-box binding factor 1 (GBF1) identical... 33 0.13 At4g36730.1 68417.m05211 G-box binding factor 1 (GBF1) identical... 33 0.13 At2g18540.1 68415.m02160 cupin family protein contains Pfam prof... 33 0.18 At1g74250.1 68414.m08599 DNAJ heat shock N-terminal domain-conta... 33 0.18 At1g03080.1 68414.m00282 kinase interacting family protein simil... 33 0.18 At5g50840.2 68418.m06299 expressed protein 32 0.31 At5g50840.1 68418.m06298 expressed protein 32 0.31 At5g42570.1 68418.m05183 expressed protein low similarity to SP|... 32 0.31 At1g58110.1 68414.m06587 bZIP family transcription factor simila... 32 0.31 At2g35330.1 68415.m04332 zinc finger (C3HC4-type RING finger) pr... 32 0.41 At1g17580.1 68414.m02165 myosin, putative similar to myosin GI:4... 32 0.41 At5g62410.1 68418.m07832 SMC2-like condensin, putative (SMC2) (T... 31 0.54 At5g23570.1 68418.m02765 XS domain-containing protein / XS zinc ... 31 0.54 At3g58050.1 68416.m06471 expressed protein 31 0.54 At3g55060.1 68416.m06115 expressed protein contains weak similar... 31 0.54 At1g47900.1 68414.m05334 expressed protein 31 0.54 At1g32530.1 68414.m04014 zinc finger (C3HC4-type RING finger) fa... 31 0.54 At1g13120.1 68414.m01521 expressed protein contains Prosite PS00... 31 0.54 At4g31570.1 68417.m04483 expressed protein 31 0.71 At1g76780.1 68414.m08935 expressed protein ; expression supporte... 31 0.94 At5g66030.2 68418.m08315 Golgi-localized GRIP domain-containing ... 30 1.2 At5g66030.1 68418.m08314 Golgi-localized GRIP domain-containing ... 30 1.2 At4g08580.1 68417.m01410 microfibrillar-associated protein-relat... 30 1.2 At3g44820.1 68416.m04829 phototropic-responsive NPH3 family prot... 30 1.2 At2g24420.2 68415.m02918 DNA repair ATPase-related contains 2 tr... 30 1.2 At2g24420.1 68415.m02917 DNA repair ATPase-related contains 2 tr... 30 1.2 At1g68790.1 68414.m07863 expressed protein 30 1.2 At1g45545.1 68414.m05199 hypothetical protein contains Pfam prof... 30 1.2 At5g17900.1 68418.m02099 expressed protein 30 1.6 At4g40060.1 68417.m05672 homeobox-leucine zipper protein 16 (HB-... 30 1.6 At2g28500.1 68415.m03463 LOB domain protein 11 / lateral organ b... 30 1.6 At2g23100.1 68415.m02756 DC1 domain-containing protein contains ... 30 1.6 At1g59990.1 68414.m06758 DEAD/DEAH box helicase, putative (RH22)... 30 1.6 At3g28580.1 68416.m03568 AAA-type ATPase family protein contains... 29 2.2 At1g56110.1 68414.m06443 nucleolar protein Nop56, putative simil... 29 2.2 At1g53050.1 68414.m06007 protein kinase family protein contains ... 29 2.2 At1g30440.1 68414.m03719 phototropic-responsive NPH3 family prot... 29 2.2 At5g16930.1 68418.m01984 AAA-type ATPase family protein contains... 29 2.9 At4g10790.1 68417.m01759 UBX domain-containing protein low simil... 29 2.9 At3g58260.1 68416.m06495 meprin and TRAF homology domain-contain... 29 2.9 At3g50930.1 68416.m05576 AAA-type ATPase family protein contains... 29 2.9 At3g19050.1 68416.m02420 kinesin motor protein-related contains ... 29 3.8 At3g11450.1 68416.m01396 DNAJ heat shock N-terminal domain-conta... 29 3.8 At2g22795.1 68415.m02704 expressed protein 29 3.8 At1g55250.1 68414.m06310 expressed protein weak similarity to PU... 29 3.8 At5g16020.1 68418.m01873 stress protein-related contains weak si... 28 5.0 At5g13340.1 68418.m01535 expressed protein 28 5.0 At4g27980.1 68417.m04014 expressed protein 28 5.0 At3g28370.1 68416.m03545 expressed protein 28 5.0 At1g65010.1 68414.m07368 expressed protein similar to endosome-a... 28 5.0 At1g20400.1 68414.m02544 myosin heavy chain-related 28 5.0 At1g08730.1 68414.m00969 myosin heavy chain (PCR43) identical to... 28 5.0 At5g44180.1 68418.m05406 homeobox transcription factor, putative... 28 6.6 At4g37820.1 68417.m05351 expressed protein Kaposi's sarcoma-asso... 28 6.6 At4g02570.1 68417.m00351 cullin family protein similar to cullin... 28 6.6 At3g22790.1 68416.m02873 kinase interacting family protein simil... 28 6.6 At1g54560.1 68414.m06222 myosin, putative similar to myosin GI:4... 28 6.6 At1g07120.1 68414.m00757 expressed protein 28 6.6 At4g32610.1 68417.m04643 mitochondrial glycoprotein family prote... 27 8.8 At4g14350.2 68417.m02211 protein kinase family protein contains ... 27 8.8 At4g14350.1 68417.m02210 protein kinase family protein contains ... 27 8.8 At3g10880.1 68416.m01310 hypothetical protein 27 8.8 At3g02930.1 68416.m00288 expressed protein ; expression support... 27 8.8 At1g67230.1 68414.m07652 expressed protein 27 8.8 At1g56040.1 68414.m06434 U-box domain-containing protein contain... 27 8.8 >At3g18480.1 68416.m02348 CCAAT displacement protein-related / CDP-related similar to CCAAT displacement protein (CDP) (Cut-like 1) (Swiss-Prot:P39880) [Homo sapiens]; contains Pfam:PF00904 Involucrin repeat Length = 689 Score = 37.9 bits (84), Expect = 0.006 Identities = 20/95 (21%), Positives = 46/95 (48%) Frame = +3 Query: 306 PSTVSRDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEE 485 P+ S + +++ ++ +NR +KVEL+ ++ L+ + ++R+ + +Q EE Sbjct: 125 PALASIAEQDRKLSEVESENRKMKVELEEFRTEATHLKNQQATIRRLEERNRQLEQQMEE 184 Query: 486 YISNTLLKKIQALKKEKETLAHHYEREEECLTNDL 590 I + K + L +E + + E+ L + L Sbjct: 185 KIKEVVEIKQRNLAEENQKTMELLKDREQALQDQL 219 >At3g07780.1 68416.m00949 expressed protein Length = 566 Score = 37.1 bits (82), Expect = 0.011 Identities = 23/86 (26%), Positives = 47/86 (54%), Gaps = 1/86 (1%) Frame = +3 Query: 315 VSRDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQ-EEEYI 491 + R + +++IE +++ R+ + E + ++L+ + E L + ++AK E+ EEEY Sbjct: 439 MERQKKKQQIEEVERIVRLKQAEAEMFQLKANEAKVEAERLERI---VKAKKEKTEEEYA 495 Query: 492 SNTLLKKIQALKKEKETLAHHYEREE 569 SN L ++ + EKE L + +E Sbjct: 496 SNYLKLRLSEAEAEKEYLFEKIKEQE 521 >At1g80790.1 68414.m09479 XH/XS domain-containing protein / XS zinc finger domain-containing protein contains Pfam domains PF03469: XH domain, PF03468: XS domain and PF03470: XS zinc finger domain Length = 634 Score = 36.3 bits (80), Expect = 0.019 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 1/103 (0%) Frame = +3 Query: 309 STVSRDQLQ-KRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEE 485 S ++++++Q K I N++ D KL+ E+ SLR+ + K E + Sbjct: 242 SDITKEEIQNKSIVVDDLANKIAMTNEDLNKLQYMN-NEKTLSLRRVLIE---KDELDRV 297 Query: 486 YISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLR 614 Y T KK+Q L +EK + RE+E LTN+L K+N L+ Sbjct: 298 YKQET--KKMQELSREK---INRIFREKERLTNELEAKMNNLK 335 >At4g03000.2 68417.m00408 expressed protein contains similarity to hypothetical proteins Length = 814 Score = 35.9 bits (79), Expect = 0.025 Identities = 25/82 (30%), Positives = 42/82 (51%) Frame = +3 Query: 327 QLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLL 506 +L K +S + Q +L+ EL + + +V LQ+E + I+A +QE+ + L Sbjct: 593 RLLKNSQSWEGQKNLLQEELKSQRDKVAGLQQEVAKAKTRQNQIEATWKQEKS-ATGKLT 651 Query: 507 KKIQALKKEKETLAHHYEREEE 572 + ALKKE+ L + EEE Sbjct: 652 AQAAALKKERGKLEELGKAEEE 673 >At4g03000.1 68417.m00407 expressed protein contains similarity to hypothetical proteins Length = 814 Score = 35.9 bits (79), Expect = 0.025 Identities = 25/82 (30%), Positives = 42/82 (51%) Frame = +3 Query: 327 QLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLL 506 +L K +S + Q +L+ EL + + +V LQ+E + I+A +QE+ + L Sbjct: 593 RLLKNSQSWEGQKNLLQEELKSQRDKVAGLQQEVAKAKTRQNQIEATWKQEKS-ATGKLT 651 Query: 507 KKIQALKKEKETLAHHYEREEE 572 + ALKKE+ L + EEE Sbjct: 652 AQAAALKKERGKLEELGKAEEE 673 >At5g48160.1 68418.m05949 tropomyosin-related contains weak similarity to Tropomyosin, muscle (Allergen Ani s 3). (Swiss-Prot:Q9NAS5) [Anisakis simplex] Length = 574 Score = 35.1 bits (77), Expect = 0.044 Identities = 21/83 (25%), Positives = 45/83 (54%) Frame = +3 Query: 321 RDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNT 500 R + + +I+ L++ R+ + E D ++L+ + E L++ ++ K+E EEY SN Sbjct: 443 RQKKKLQIDELERIVRLKQAEADMFQLKANEAKREADRLQRIVLAKMDKSE--EEYASNY 500 Query: 501 LLKKIQALKKEKETLAHHYEREE 569 L +++ + EK+ L + +E Sbjct: 501 LKQRLSEAEAEKQYLFEKIKLQE 523 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 35.1 bits (77), Expect = 0.044 Identities = 24/101 (23%), Positives = 50/101 (49%) Frame = +3 Query: 321 RDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNT 500 + Q +KR E ++ + K + ++ L+ K +EE + +++ K E ++E+ N Sbjct: 1032 KSQDKKREEKDSEERKSKKEKEESRDLKAKKKEEETKEKKESENHKSKKKEDKKEHEDNK 1091 Query: 501 LLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 +KK + KKEK+ R++E D+ + +Q +K Sbjct: 1092 SMKK-EEDKKEKKKHEESKSRKKEEDKKDMEKLEDQNSNKK 1131 >At5g10500.1 68418.m01216 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 848 Score = 34.7 bits (76), Expect = 0.058 Identities = 24/83 (28%), Positives = 42/83 (50%) Frame = +3 Query: 372 LKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAH 551 L+ E+D K +++ALQ+EN S + K +E E N + Q ++++ + + Sbjct: 363 LREEIDDLKAQIRALQKENNSSQTDDNMDMGKKLKEMEEKVNGVKDIDQEVEEKSDNIDK 422 Query: 552 HYEREEECLTNDLSRKLNQLRQE 620 H R L + LS++L L QE Sbjct: 423 HLTRAHMKL-SFLSKRLKSLTQE 444 >At2g46270.1 68415.m05753 G-box binding factor 3 (GBF3) identical to G-box binding factor 3 (GBF3) SP:P42776 from [Arabidopsis thaliana]; contains Pfam profile: PF00170 bZIP transcription factor Length = 382 Score = 34.3 bits (75), Expect = 0.076 Identities = 29/109 (26%), Positives = 55/109 (50%), Gaps = 8/109 (7%) Frame = +3 Query: 294 AMLPPSTVSRDQLQKRIESLQQQNRV------LKVELDTYKL--RVKALQEENRSLRQAS 449 AM+PP T +++ + + E +Q NR L+ + +T +L +V+AL EN +LR Sbjct: 246 AMVPPETWLQNERELKRERRKQSNRESARRSRLRKQAETEELARKVEALTAENMALRSEL 305 Query: 450 VSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSR 596 + K+++ + TLL K++ + EK A+ R + D ++ Sbjct: 306 NQLNEKSDKLRG-ANATLLDKLKCSEPEKRVPANMLSRVKNSGAGDKNK 353 >At5g52280.1 68418.m06488 protein transport protein-related low similarity to SP|P25386 Intracellular protein transport protein USO1 {Saccharomyces cerevisiae} Length = 853 Score = 33.9 bits (74), Expect = 0.10 Identities = 25/105 (23%), Positives = 53/105 (50%), Gaps = 6/105 (5%) Frame = +3 Query: 324 DQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTL 503 + L ++S +++N ++ LD ++L+EEN + + Q + E+EY+ + Sbjct: 434 EDLDWELDSYKKKNEEQEILLDELTQEYESLKEENYKNVSSKLEQQECSNAEDEYLDSKD 493 Query: 504 LKKIQALKKEKETLAHHYERE----EECL--TNDLSRKLNQLRQE 620 + I LK + E L +++ ECL N+L ++ +L++E Sbjct: 494 I--IDELKSQIEILEGKLKQQSLEYSECLITVNELESQVKELKKE 536 >At1g13220.2 68414.m01534 nuclear matrix constituent protein-related similar to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 1128 Score = 33.9 bits (74), Expect = 0.10 Identities = 23/96 (23%), Positives = 45/96 (46%) Frame = +3 Query: 333 QKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKK 512 + ++ +++ LK+ L + R LQ+E S + S + +++ EY+ N KK Sbjct: 213 ESKLAEATRKSSELKLRLKEVETRESVLQQERLSFTKERESYEGTFQKQREYL-NEWEKK 271 Query: 513 IQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQE 620 +Q K+E T + E N++ +KL +E Sbjct: 272 LQG-KEESITEQKRNLNQREEKVNEIEKKLKLKEKE 306 >At1g13220.1 68414.m01533 nuclear matrix constituent protein-related similar to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 391 Score = 33.9 bits (74), Expect = 0.10 Identities = 23/96 (23%), Positives = 45/96 (46%) Frame = +3 Query: 333 QKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKK 512 + ++ +++ LK+ L + R LQ+E S + S + +++ EY+ N KK Sbjct: 226 ESKLAEATRKSSELKLRLKEVETRESVLQQERLSFTKERESYEGTFQKQREYL-NEWEKK 284 Query: 513 IQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQE 620 +Q K+E T + E N++ +KL +E Sbjct: 285 LQG-KEESITEQKRNLNQREEKVNEIEKKLKLKEKE 319 >At5g67320.1 68418.m08490 WD-40 repeat family protein strong similarity to unknown protein (ref|NP_005638.1) Length = 613 Score = 33.5 bits (73), Expect = 0.13 Identities = 26/112 (23%), Positives = 55/112 (49%), Gaps = 3/112 (2%) Frame = +3 Query: 303 PPSTVSRD--QLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQ 476 P +S+D +LQ + +++ R ++ E D K K ++ E+ R + +Q Sbjct: 83 PLDLISKDVKELQDMLREKKRKERDMEKERDRSKENDKGVEREHEGDRNRAKEKDRHEKQ 142 Query: 477 EEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDL-SRKLNQLRQEKCR 629 +E L++ + ++E+E + ERE E + ++ R+ ++L+ EK R Sbjct: 143 KEREREREKLEREK--EREREKIEREKEREREKMEREIFEREKDRLKLEKER 192 >At4g36730.2 68417.m05212 G-box binding factor 1 (GBF1) identical to G-box binding factor 1 SP:P42774 from [Arabidopsis thaliana]; contains Pfam profile: PF00170 bZIP transcription factor Length = 313 Score = 33.5 bits (73), Expect = 0.13 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +3 Query: 324 DQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLR 440 +QLQ+R+ESL +N+ L+ EL L+ EN S++ Sbjct: 246 EQLQQRVESLSNENQSLRDELQRLSSECDKLKSENNSIQ 284 >At4g36730.1 68417.m05211 G-box binding factor 1 (GBF1) identical to G-box binding factor 1 SP:P42774 from [Arabidopsis thaliana]; contains Pfam profile: PF00170 bZIP transcription factor Length = 315 Score = 33.5 bits (73), Expect = 0.13 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +3 Query: 324 DQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLR 440 +QLQ+R+ESL +N+ L+ EL L+ EN S++ Sbjct: 248 EQLQQRVESLSNENQSLRDELQRLSSECDKLKSENNSIQ 286 >At2g18540.1 68415.m02160 cupin family protein contains Pfam profile PF00190: Cupin Length = 707 Score = 33.1 bits (72), Expect = 0.18 Identities = 20/101 (19%), Positives = 46/101 (45%) Frame = +3 Query: 321 RDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNT 500 R++ +K+ E +Q R + E + + K +EE + + V + + EQE + Sbjct: 502 REEERKKREEEAEQARKREEEREKEEEMAKKREEERQRKEREEVERKRREEQERKRREEE 561 Query: 501 LLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 K+ + K+E+E + + ++ RK+ + ++ K Sbjct: 562 ARKREEERKREEEMAKRREQERQRKEREEVERKIREEQERK 602 >At1g74250.1 68414.m08599 DNAJ heat shock N-terminal domain-containing protein contains Pfam domains PF00226: DnaJ domain and PF00096: Zinc finger, C2H2 type Length = 630 Score = 33.1 bits (72), Expect = 0.18 Identities = 23/85 (27%), Positives = 40/85 (47%) Frame = +3 Query: 318 SRDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISN 497 S + +++ E LQ++ + E D K V E + A +Q +E E+E Sbjct: 361 SPESVEELHEKLQEELNIDNEERDVKKEVVGEADETDDEYFVAEEDMQGSSESEDEDDEM 420 Query: 498 TLLKKIQALKKEKETLAHHYEREEE 572 TLLKK+ + +K K+ E +E+ Sbjct: 421 TLLKKMVSGQKNKQKNVVSKEEDED 445 >At1g03080.1 68414.m00282 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1744 Score = 33.1 bits (72), Expect = 0.18 Identities = 26/96 (27%), Positives = 51/96 (53%), Gaps = 1/96 (1%) Frame = +3 Query: 324 DQLQKRIESLQQQNRVLKVE-LDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNT 500 D ++KRIE L++++ LKV+ L+ R +LQ+ + + VS+ AK + EY S Sbjct: 786 DTMRKRIEDLEKEHAELKVKVLELATERESSLQK----IEELGVSLNAK---DCEYAS-- 836 Query: 501 LLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQ 608 ++ ++ E+ HH + E +C + +L++ Sbjct: 837 FVQFSESRMNGMESTIHHLQDENQCRVREYQVELDR 872 >At5g50840.2 68418.m06299 expressed protein Length = 405 Score = 32.3 bits (70), Expect = 0.31 Identities = 24/99 (24%), Positives = 49/99 (49%), Gaps = 1/99 (1%) Frame = +3 Query: 321 RDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEE-NRSLRQASVSIQAKAEQEEEYISN 497 RD+L+ LQ+QN++L E + L+ + + + A + + K + E++ S Sbjct: 162 RDKLESLCRELQRQNKMLMEECKRVSTEGQTLRSDLSTKFQDAIMDVSIKLD-EQKNESL 220 Query: 498 TLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLR 614 T LK+ + L+ + + LA + E+ L +K +L+ Sbjct: 221 TQLKENEMLRTKLKHLADQFMLSEQQHEQRLKQKTLELQ 259 Score = 27.5 bits (58), Expect = 8.8 Identities = 23/94 (24%), Positives = 45/94 (47%), Gaps = 7/94 (7%) Frame = +3 Query: 312 TVSRDQLQKRIESLQQQNRVL---KVELDTYKLRVKALQEENRSLR----QASVSIQAKA 470 T D+ Q+ ++L + N V K E+D +K L++EN L+ ++ +++ Sbjct: 301 TSDGDKFQQFQDALVKSNEVFETFKQEIDKMSKAIKELRKENAFLKNKTEKSDITLIELV 360 Query: 471 EQEEEYISNTLLKKIQALKKEKETLAHHYEREEE 572 E+ E LL+K + K + E+L + E + Sbjct: 361 EERERL--KKLLEKTKKQKDKLESLCRSLQAERK 392 >At5g50840.1 68418.m06298 expressed protein Length = 404 Score = 32.3 bits (70), Expect = 0.31 Identities = 24/99 (24%), Positives = 49/99 (49%), Gaps = 1/99 (1%) Frame = +3 Query: 321 RDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEE-NRSLRQASVSIQAKAEQEEEYISN 497 RD+L+ LQ+QN++L E + L+ + + + A + + K + E++ S Sbjct: 161 RDKLESLCRELQRQNKMLMEECKRVSTEGQTLRSDLSTKFQDAIMDVSIKLD-EQKNESL 219 Query: 498 TLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLR 614 T LK+ + L+ + + LA + E+ L +K +L+ Sbjct: 220 TQLKENEMLRTKLKHLADQFMLSEQQHEQRLKQKTLELQ 258 Score = 27.5 bits (58), Expect = 8.8 Identities = 23/94 (24%), Positives = 45/94 (47%), Gaps = 7/94 (7%) Frame = +3 Query: 312 TVSRDQLQKRIESLQQQNRVL---KVELDTYKLRVKALQEENRSLR----QASVSIQAKA 470 T D+ Q+ ++L + N V K E+D +K L++EN L+ ++ +++ Sbjct: 300 TSDGDKFQQFQDALVKSNEVFETFKQEIDKMSKAIKELRKENAFLKNKTEKSDITLIELV 359 Query: 471 EQEEEYISNTLLKKIQALKKEKETLAHHYEREEE 572 E+ E LL+K + K + E+L + E + Sbjct: 360 EERERL--KKLLEKTKKQKDKLESLCRSLQAERK 391 >At5g42570.1 68418.m05183 expressed protein low similarity to SP|P51572 B-cell receptor-associated protein 31 (6C6-AG tumor-associated antigen) (DXS1357E) {Homo sapiens} Length = 218 Score = 32.3 bits (70), Expect = 0.31 Identities = 20/78 (25%), Positives = 43/78 (55%) Frame = +3 Query: 330 LQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLK 509 L+K +E+ ++QNR + T VKAL EE +L+ ++++++E + + + Sbjct: 117 LRKTMETAKKQNRGFEDGKTTSGEEVKALGEEIAALKAKIKTLESESESKGKELKGA-QG 175 Query: 510 KIQALKKEKETLAHHYER 563 + +AL+K+ + Y+R Sbjct: 176 ETEALRKQADGFLMEYDR 193 >At1g58110.1 68414.m06587 bZIP family transcription factor similar to bZIP transcriptional activator RSG GI:8777512 from [Nicotiana tabacum]; contains PFAM profile: bZIP transcription factor PF00170 Length = 374 Score = 32.3 bits (70), Expect = 0.31 Identities = 20/97 (20%), Positives = 47/97 (48%), Gaps = 2/97 (2%) Frame = +3 Query: 327 QLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSL--RQASVSIQAKAEQEEEYISNT 500 +L++ +++LQ + + ELD R L EN++L R S++ + +Q E+ + Sbjct: 256 ELERNVQTLQAEGSKVSAELDFLNQRNLILSMENKALKKRLESIAQEKLIKQLEQEVLEK 315 Query: 501 LLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQL 611 + +++AL ++++ + DL + + L Sbjct: 316 EIGRLRALYQQQQQTQKPSASRGRATSKDLDSQFSSL 352 >At2g35330.1 68415.m04332 zinc finger (C3HC4-type RING finger) protein-related contains weak hit to Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger); weak similarity to RING finger protein 8 (Swiss-Prot:O76064) [Homo sapiens] Length = 738 Score = 31.9 bits (69), Expect = 0.41 Identities = 19/81 (23%), Positives = 41/81 (50%) Frame = +3 Query: 336 KRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKI 515 K++ + ++Q L+ E+ K ++KAL + Q +AK QE++ +L ++ Sbjct: 526 KKLLAWEKQKMKLQDEITAEKEKIKALNRALAQITQEEKEYEAKWRQEQK-AKEQVLAQV 584 Query: 516 QALKKEKETLAHHYEREEECL 578 + ++ KE + +R+ E L Sbjct: 585 EEEQRSKEAIEASNKRKVESL 605 >At1g17580.1 68414.m02165 myosin, putative similar to myosin GI:433663 from (Arabidopsis thaliana) Length = 1520 Score = 31.9 bits (69), Expect = 0.41 Identities = 26/104 (25%), Positives = 54/104 (51%), Gaps = 2/104 (1%) Frame = +3 Query: 315 VSRDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYIS 494 V ++L K++E ++ L+ + ++ +V +L+ EN+ LRQ +++I Sbjct: 1004 VQNEELCKKLEEAGRKIDQLQDSVQRFQEKVFSLESENKVLRQQTLTISPTTRALALRPK 1063 Query: 495 NTLLKKIQALKKEKETLAHHYERE-EECLTNDLSRK-LNQLRQE 620 T++++ EK+T ++ + +E T D +K LNQ +QE Sbjct: 1064 TTIIQR----TPEKDTFSNGETTQLQEPETEDRPQKSLNQKQQE 1103 >At5g62410.1 68418.m07832 SMC2-like condensin, putative (SMC2) (TITAN3) very strong similarity to SMC2-like condensin (TITAN3) [Arabidopsis thaliana] GI:14279543; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1175 Score = 31.5 bits (68), Expect = 0.54 Identities = 24/102 (23%), Positives = 49/102 (48%), Gaps = 1/102 (0%) Frame = +3 Query: 321 RDQLQKRIESLQQQNRVLKVELDTYKLRVKALQE-ENRSLRQASVSIQAKAEQEEEYISN 497 + L+ + SL+ Q L E+D + +V ALQ+ + SL + + I AK ++ + IS Sbjct: 831 QSSLESHLTSLETQISTLTSEVDEQRAKVDALQKIHDESLAELKL-IHAKMKECDTQISG 889 Query: 498 TLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 + + + L+K + + E E + + K ++ +K Sbjct: 890 FVTDQEKCLQKLSDMKLERKKLENEVVRMETDHKDCSVKVDK 931 >At5g23570.1 68418.m02765 XS domain-containing protein / XS zinc finger domain-containing protein-related contains Pfam profiles PF03468: XS domain, weak hit to PF03470: XS zinc finger domain Length = 625 Score = 31.5 bits (68), Expect = 0.54 Identities = 21/81 (25%), Positives = 35/81 (43%), Gaps = 1/81 (1%) Frame = +3 Query: 321 RDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYI-SN 497 RD ++ E LQQQ R V + + + + + S I+ + ++ EE++ Sbjct: 519 RDAKEENFEMLQQQERAKVVGQQQQNINPSSNDDCRKRAEEVSSFIEFQEKEMEEFVEER 578 Query: 498 TLLKKIQALKKEKETLAHHYE 560 +L K Q K E HH E Sbjct: 579 EMLIKDQEKKMEDMKKRHHEE 599 >At3g58050.1 68416.m06471 expressed protein Length = 1209 Score = 31.5 bits (68), Expect = 0.54 Identities = 25/94 (26%), Positives = 45/94 (47%) Frame = +3 Query: 342 IESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQA 521 ++ L+Q V E+ T + +VK L+EE + R+ + K +E E KK++ Sbjct: 508 LKLLEQHLHVACKEIITLEKQVKLLEEEEKEKREEEERKEKKRSKERE-------KKLRK 560 Query: 522 LKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 ++ KE ++ EC D+ LN R+E+ Sbjct: 561 KERLKEKDKGKEKKNPECSDKDM--LLNSSREEE 592 >At3g55060.1 68416.m06115 expressed protein contains weak similarity to intracellular protein transport protein USO1 (Swiss-Prot:P25386) [Saccharomyces cerevisiae]; expression supported by MPSS Length = 896 Score = 31.5 bits (68), Expect = 0.54 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 2/71 (2%) Frame = +3 Query: 423 ENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKL 602 EN +L ++ + +A A +E ++ + IQ L+KEK L E+E + + + + KL Sbjct: 360 ENVNLLRSQIVERASAREEIRWLKSDWDLHIQRLEKEKSELQAGLEKELDRRSGEWTSKL 419 Query: 603 N--QLRQEKCR 629 QL ++K R Sbjct: 420 EKFQLEEKKLR 430 >At1g47900.1 68414.m05334 expressed protein Length = 1054 Score = 31.5 bits (68), Expect = 0.54 Identities = 24/101 (23%), Positives = 46/101 (45%) Frame = +3 Query: 324 DQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTL 503 D + IE L+ + + V+++ K + LQE + L A + Q + Q +++T Sbjct: 790 DSKLQEIEELRSEKEKMAVDIEGLKCQ---LQESEQLL--ADIRSQFDSAQRSNRLADTQ 844 Query: 504 LKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKC 626 L+ + + E+ A E + L + + N+L EKC Sbjct: 845 LRCMTESYRSLESRAADLEIDVNQLKEKIQKLENELEDEKC 885 Score = 27.9 bits (59), Expect = 6.6 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 1/86 (1%) Frame = +3 Query: 324 DQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTL 503 +Q+QK E ++ N L V + + +AL +++ + + +VS KA+ E + NT Sbjct: 106 EQVQKLNEDVEDLNEKLSVANEEIVTK-EALVKQHSKVAEDAVSGWEKADAEALALKNT- 163 Query: 504 LKKIQALKKEKETLAHHYERE-EECL 578 L+ + K E A H + +EC+ Sbjct: 164 LESVTLSKLTAEDRAAHLDGALKECM 189 >At1g32530.1 68414.m04014 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger); weak similarity to interaptin (GI:3549261) [Dictyostelium discoideum] weak similarity to Axoneme-associated protein mst101(2) (Swiss-Prot:Q08696) [Drosophila hydei] Length = 711 Score = 31.5 bits (68), Expect = 0.54 Identities = 20/81 (24%), Positives = 42/81 (51%) Frame = +3 Query: 336 KRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKI 515 K++ + ++Q L+ E+ K ++KAL + + + I+AK QE++ L ++ Sbjct: 499 KKLVAWEKQILKLQDEITAEKEKIKALYKTLAQITEYEKEIEAKWRQEQK-AKEEALAQM 557 Query: 516 QALKKEKETLAHHYEREEECL 578 + ++ KE H +R+ E L Sbjct: 558 EEEQRSKEAAEGHNKRKLETL 578 >At1g13120.1 68414.m01521 expressed protein contains Prosite PS00012: Phosphopantetheine attachment site; similar to GLE1 (GI:3288817) {Homo sapiens}; EST gb|N37870 comes from this gene Length = 611 Score = 31.5 bits (68), Expect = 0.54 Identities = 19/72 (26%), Positives = 41/72 (56%) Frame = +3 Query: 324 DQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTL 503 + L + ++Q+++++ K +++ K+R + QEE R R+ + K QE+ + Sbjct: 197 EALDTHLTAVQREHKI-KSQIEERKIRSEEAQEEAR--RKERAHQEEKIRQEKARAEAQM 253 Query: 504 LKKIQALKKEKE 539 L KI+A +++KE Sbjct: 254 LAKIRAEEEKKE 265 >At4g31570.1 68417.m04483 expressed protein Length = 2712 Score = 31.1 bits (67), Expect = 0.71 Identities = 19/97 (19%), Positives = 50/97 (51%) Frame = +3 Query: 330 LQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLK 509 L K ++ ++ + E D Y + ++L EN +L + + +Q +QEE+ S ++ + Sbjct: 1805 LTKDLDQALHVQKLTREERDLYMAKQQSLVAENEALDKKIIELQEFLKQEEQK-SASVRE 1863 Query: 510 KIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQE 620 K+ ++ + L + ++ + +++ +L +L+ E Sbjct: 1864 KLNVAVRKGKALVQQRDSLKQTI-EEVNAELGRLKSE 1899 >At1g76780.1 68414.m08935 expressed protein ; expression supported by MPSS Length = 1871 Score = 30.7 bits (66), Expect = 0.94 Identities = 19/68 (27%), Positives = 38/68 (55%), Gaps = 2/68 (2%) Frame = +3 Query: 345 ESLQQQNRVLKVELDTYKLRVKALQE-ENRSLRQASVS-IQAKAEQEEEYISNTLLKKIQ 518 E Q++N + K EL+T + K ++E E + + S +QAK ++ EE ++K + Sbjct: 1076 EEEQKENVIAKAELNTEEDSFKKVEEIEKQDHGELKRSMVQAKRQETEEKDKTRAMEKNE 1135 Query: 519 ALKKEKET 542 +++ K+T Sbjct: 1136 TVERRKQT 1143 >At5g66030.2 68418.m08315 Golgi-localized GRIP domain-containing protein contains Pfam profile PF01465: GRIP domain; supporting cDNA gi|20303028|gb|AF499634.1| Length = 765 Score = 30.3 bits (65), Expect = 1.2 Identities = 26/112 (23%), Positives = 49/112 (43%) Frame = +3 Query: 288 GGAMLPPSTVSRDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAK 467 G ++ V D Q ++ LQ+Q L E+D K A ++ LR+A AK Sbjct: 68 GRSLQKAEQVEADSAQ--LKQLQEQVASLSREIDVEKQTRVAAEQALEHLREAYSEADAK 125 Query: 468 AEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 +++ S K Q +K+ E A + + L +++ ++++EK Sbjct: 126 SQEYSSKFSQVEQKLDQEIKERDEKYA-DLDAKFTRLHKRAKQRIQEIQKEK 176 >At5g66030.1 68418.m08314 Golgi-localized GRIP domain-containing protein contains Pfam profile PF01465: GRIP domain; supporting cDNA gi|20303028|gb|AF499634.1| Length = 788 Score = 30.3 bits (65), Expect = 1.2 Identities = 26/112 (23%), Positives = 49/112 (43%) Frame = +3 Query: 288 GGAMLPPSTVSRDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAK 467 G ++ V D Q ++ LQ+Q L E+D K A ++ LR+A AK Sbjct: 68 GRSLQKAEQVEADSAQ--LKQLQEQVASLSREIDVEKQTRVAAEQALEHLREAYSEADAK 125 Query: 468 AEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 +++ S K Q +K+ E A + + L +++ ++++EK Sbjct: 126 SQEYSSKFSQVEQKLDQEIKERDEKYA-DLDAKFTRLHKRAKQRIQEIQKEK 176 >At4g08580.1 68417.m01410 microfibrillar-associated protein-related similar to Microfibrillar-associated protein 1 (Associated microfibril protein) (AMF) (Swiss-Prot:P55080) [Gallus gallus] Length = 435 Score = 30.3 bits (65), Expect = 1.2 Identities = 34/113 (30%), Positives = 53/113 (46%), Gaps = 21/113 (18%) Frame = +3 Query: 345 ESLQQQNRVLKVELDTYKLRVKALQEEN--RSLRQASV-------SIQAKAEQEEEYISN 497 ES Q+NR + D + R + ++E+N R+ +A++ IQ + E+EEE Sbjct: 109 ESRNQENRDEDDDEDALEERRRRIKEKNLRRAQEEAALLPLEEEDEIQEEEEEEEESEYE 168 Query: 498 T----------LLKKIQALKKEKETLA--HHYEREEECLTNDLSRKLNQLRQE 620 T L+K + K E++T+A E EEE L RKL Q + E Sbjct: 169 TDSEDDMPGIALIKPVFVPKAERDTIAERERLEAEEEALEELAKRKLEQRKIE 221 >At3g44820.1 68416.m04829 phototropic-responsive NPH3 family protein contains NPH3 family domain, Pfam:PF03000 Length = 661 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/29 (44%), Positives = 22/29 (75%) Frame = +3 Query: 357 QQNRVLKVELDTYKLRVKALQEENRSLRQ 443 +QN+VLKV++ + RV L+EE +S++Q Sbjct: 561 RQNQVLKVDMQKMRSRVGELEEEFQSIKQ 589 >At2g24420.2 68415.m02918 DNA repair ATPase-related contains 2 transmembrane domains; similar to DNA double-strand break repair rad50 ATPase. (Swiss-Prot:O33600) [Sulfolobus acidocaldarius] Length = 440 Score = 30.3 bits (65), Expect = 1.2 Identities = 26/96 (27%), Positives = 51/96 (53%), Gaps = 1/96 (1%) Frame = +3 Query: 327 QLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLL 506 +L+ R E + ++ ++L+ D +V +L+ E SLR+ S + + + + L Sbjct: 66 ELKGREELVTEKEKLLQERQD----KVASLETEVSSLRKKGSSDSVELLSKAQARATELE 121 Query: 507 KKIQALKKEKETLAHHYERE-EECLTNDLSRKLNQL 611 K+++ LKK E + E+E E T++ +KLN+L Sbjct: 122 KQVEVLKKFLE--QKNKEKELIEAQTSETEKKLNEL 155 >At2g24420.1 68415.m02917 DNA repair ATPase-related contains 2 transmembrane domains; similar to DNA double-strand break repair rad50 ATPase. (Swiss-Prot:O33600) [Sulfolobus acidocaldarius] Length = 440 Score = 30.3 bits (65), Expect = 1.2 Identities = 26/96 (27%), Positives = 51/96 (53%), Gaps = 1/96 (1%) Frame = +3 Query: 327 QLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLL 506 +L+ R E + ++ ++L+ D +V +L+ E SLR+ S + + + + L Sbjct: 66 ELKGREELVTEKEKLLQERQD----KVASLETEVSSLRKKGSSDSVELLSKAQARATELE 121 Query: 507 KKIQALKKEKETLAHHYERE-EECLTNDLSRKLNQL 611 K+++ LKK E + E+E E T++ +KLN+L Sbjct: 122 KQVEVLKKFLE--QKNKEKELIEAQTSETEKKLNEL 155 >At1g68790.1 68414.m07863 expressed protein Length = 1085 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/74 (21%), Positives = 37/74 (50%) Frame = +3 Query: 321 RDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNT 500 R++L++ E +++ L + + EEN LR +S + + ++EE + Sbjct: 522 REELKQDKERFEKEWEALDKKRANITREQNEVAEENEKLRNLQISEKHRLKREEMTSRDN 581 Query: 501 LLKKIQALKKEKET 542 L +++ +K +KE+ Sbjct: 582 LKRELDGVKMQKES 595 >At1g45545.1 68414.m05199 hypothetical protein contains Pfam profile PF05701: Plant protein of unknown function (DUF827) Length = 752 Score = 30.3 bits (65), Expect = 1.2 Identities = 27/103 (26%), Positives = 47/103 (45%), Gaps = 2/103 (1%) Frame = +3 Query: 324 DQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNT- 500 D ++ ++++ + L+ E+ YK + + N S QA+V K + EE ISN Sbjct: 397 DDVKTKLKTASALQQDLRAEIAAYK--DSNMGKRNNSDIQAAVDSARK--ELEEVISNIE 452 Query: 501 -LLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKC 626 +++ LK +L RE+ L+ R R+EKC Sbjct: 453 KANSEVKTLKIIVGSLQSELAREKHDLSETRQRNREDTREEKC 495 >At5g17900.1 68418.m02099 expressed protein Length = 435 Score = 29.9 bits (64), Expect = 1.6 Identities = 33/113 (29%), Positives = 53/113 (46%), Gaps = 21/113 (18%) Frame = +3 Query: 345 ESLQQQNRVLKVELDTYKLRVKALQEEN--RSLRQASV-------SIQAKAEQEEEYISN 497 ES Q+NR + D + R + ++E+N R+ +A++ IQ + E+EEE Sbjct: 109 ESRNQENRDEDDDEDALEERRRRIREKNLRRAQEEAALLPLEEEDEIQEEEEEEEESEYE 168 Query: 498 T----------LLKKIQALKKEKETLA--HHYEREEECLTNDLSRKLNQLRQE 620 T ++K + K E++T+A E EEE L RKL Q + E Sbjct: 169 TDSEDDMPGIAMIKPVFVPKAERDTIAERERLEAEEEALEELAKRKLEQRKLE 221 >At4g40060.1 68417.m05672 homeobox-leucine zipper protein 16 (HB-16) / HD-ZIP transcription factor 16 identical to homeodomain leucine-zipper protein ATHB-16 (GP:5668909|) {Arabidopsis thaliana} Length = 294 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/66 (27%), Positives = 36/66 (54%) Frame = +3 Query: 339 RIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQ 518 + + L++ VLK + D+ + +L+ +N SL Q I+AK EE+ +N + + Sbjct: 112 KTKQLEKDYGVLKGQYDSLRHNFDSLRRDNDSLLQEISKIKAKVNGEEDNNNNKAI--TE 169 Query: 519 ALKKEK 536 +K+E+ Sbjct: 170 GVKEEE 175 >At2g28500.1 68415.m03463 LOB domain protein 11 / lateral organ boundaries domain protein 11 (LBD11) identical to SP|Q9SK08 LOB domain protein 11 {Arabidopsis thaliana} Length = 229 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/56 (28%), Positives = 32/56 (57%) Frame = +3 Query: 330 LQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISN 497 LQ+++ LQ Q +VEL +L+ +L E ++ Q +S+Q + +Q+ + S+ Sbjct: 134 LQRQVSELQAQLAKTQVELVGMQLQRSSLLELIYNMEQTKLSVQEQGQQKMSFESS 189 >At2g23100.1 68415.m02756 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 711 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -2 Query: 676 IYFTKHSC-SCSNVCSRRHFSCLN*FNFL 593 I TK +C CSN CSR++ CL +FL Sbjct: 536 INLTKGACMGCSNACSRKYLECLICDSFL 564 >At1g59990.1 68414.m06758 DEAD/DEAH box helicase, putative (RH22) similar to RNA helicase GI:3776015 from [Arabidopsis thaliana]; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00270: DEAD/DEAH box helicase; matches EST OAO811-2 Length = 581 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/55 (23%), Positives = 29/55 (52%) Frame = +3 Query: 333 QKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISN 497 +K++ L + N +E+D ++ E++ + S+S + E+EEEY+ + Sbjct: 269 EKQVSRLAKSNLGRPMEIDASVPQIDLENEDDAEFDEGSISEEEDEEEEEEYLDD 323 >At3g28580.1 68416.m03568 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 500 Score = 29.5 bits (63), Expect = 2.2 Identities = 18/55 (32%), Positives = 26/55 (47%) Frame = +3 Query: 408 KALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEE 572 + L+ E + A V + E+E L + I+ALK+EKE E EEE Sbjct: 420 RLLEVEEIKMTPADVGENLLPKSEKEGGETCLKRLIEALKEEKEEAKKKVEEEEE 474 >At1g56110.1 68414.m06443 nucleolar protein Nop56, putative similar to XNop56 protein [Xenopus laevis] GI:14799394; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 522 Score = 29.5 bits (63), Expect = 2.2 Identities = 22/89 (24%), Positives = 42/89 (47%), Gaps = 6/89 (6%) Frame = +3 Query: 321 RDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQ------AKAEQEE 482 R+Q+++R+E + + +D K ++ L++E S++ AK E+EE Sbjct: 401 REQVEERLE-FYDKGVAPRKNVDVMKEVIENLKQEEEGKEPVDASVKKSKKKKAKGEEEE 459 Query: 483 EYISNTLLKKIQALKKEKETLAHHYEREE 569 E ++ K + KKEK + E E+ Sbjct: 460 EVVAMEEDKSEKKKKKEKRKMETAEENEK 488 >At1g53050.1 68414.m06007 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 694 Score = 29.5 bits (63), Expect = 2.2 Identities = 17/61 (27%), Positives = 28/61 (45%) Frame = -3 Query: 363 FVAVEIQFFSVVDHEKQYSEEALRHRQVNWSHFRTPNLPFYDLVKLQNHPFARVTRTATK 184 F+A EIQ +DH E L +++ S + +DL L +HP + + + K Sbjct: 177 FMAREIQILRRLDHPNIIKLEGLVTSRMSCSLYLVFEYMEHDLAGLASHPAIKFSESQVK 236 Query: 183 C 181 C Sbjct: 237 C 237 >At1g30440.1 68414.m03719 phototropic-responsive NPH3 family protein contains NPH3 family domain, Pfam:PF03000 Length = 665 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/29 (41%), Positives = 23/29 (79%) Frame = +3 Query: 357 QQNRVLKVELDTYKLRVKALQEENRSLRQ 443 ++N+VLKV +D+ ++RV L++E ++RQ Sbjct: 554 RENQVLKVGMDSMRMRVCELEKECSNMRQ 582 >At5g16930.1 68418.m01984 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family Length = 644 Score = 29.1 bits (62), Expect = 2.9 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 2/80 (2%) Frame = +3 Query: 333 QKRIESLQQQNR--VLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLL 506 QK++ Q Q + + + E + + R++A E R+ Q V +Q ++ E Sbjct: 151 QKKLAQHQAQTKSQMARYEDELARKRMQAENEAQRTRNQELVKMQEESAIRREVARRATE 210 Query: 507 KKIQALKKEKETLAHHYERE 566 ++IQA +++ E ERE Sbjct: 211 EEIQAQRRQTEREKAEIERE 230 >At4g10790.1 68417.m01759 UBX domain-containing protein low similarity to SP|Q9UNN5 FAS-associated factor 1 (FAF1 protein) {Homo sapiens}; contains Pfam profile PF00789: UBX domain Length = 480 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/67 (20%), Positives = 31/67 (46%) Frame = +3 Query: 285 DGGAMLPPSTVSRDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQA 464 D L + V ++ + + ++Q+ + L+ + R + QEE L + + + Sbjct: 300 DSSPTLVTARVEAEERRTNLRLREEQDAAYRAALEADQAREQQRQEEKERLEREAAEAER 359 Query: 465 KAEQEEE 485 K ++EEE Sbjct: 360 KLKEEEE 366 >At3g58260.1 68416.m06495 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 321 Score = 29.1 bits (62), Expect = 2.9 Identities = 17/53 (32%), Positives = 34/53 (64%) Frame = +3 Query: 324 DQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEE 482 D L+K+++ L ++ K E D K+R++ ++EE + LRQ S++A ++E+ Sbjct: 234 DWLEKKLDELFEKK---KEEAD--KIRMQNIEEELKDLRQKCSSLEALLKKEK 281 >At3g50930.1 68416.m05576 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 576 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/64 (23%), Positives = 31/64 (48%) Frame = +3 Query: 324 DQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTL 503 D + K +E L + +V K+E + K + + + EN+ + K E +E+ + N Sbjct: 485 DSVDKVLEGLIEFLKVKKIENEQDKAKTEKQELENKKKTKEGTDSVVKKEVDEQLVRNDR 544 Query: 504 LKKI 515 + K+ Sbjct: 545 VDKV 548 >At3g19050.1 68416.m02420 kinesin motor protein-related contains Pfam profile: PF00225 Kinesin motor domain; contains non-consensus splice site (GC) at intron 12 Length = 2722 Score = 28.7 bits (61), Expect = 3.8 Identities = 23/81 (28%), Positives = 38/81 (46%) Frame = +3 Query: 330 LQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLK 509 L+K E L+++N VLK++LD E N LR+A VS+ E+ Y ++++ Sbjct: 2551 LKKENELLKEENNVLKLQLD----------ELNLKLRRADVSVSRAKEELAFYRASSVKN 2600 Query: 510 KIQALKKEKETLAHHYEREEE 572 K + E EE+ Sbjct: 2601 PHSNFDKTHQLSTKLKETEED 2621 >At3g11450.1 68416.m01396 DNAJ heat shock N-terminal domain-containing protein / cell division protein-related similar to GlsA [Volvox carteri f. nagariensis] GI:4633129; contains Pfam profiles PF00226 DnaJ domain, PF00249 Myb-like DNA-binding domain Length = 663 Score = 28.7 bits (61), Expect = 3.8 Identities = 28/107 (26%), Positives = 45/107 (42%), Gaps = 7/107 (6%) Frame = +3 Query: 324 DQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAK-----AEQEEEY 488 D+ + +E + +E + K VKA +EE+ +R + K +EEE Sbjct: 263 DEEEHDLEQADSREERRWMEKENAKKTVKARKEEHARIRTLVDNAYRKDPRIVKRKEEEK 322 Query: 489 ISNTLLK--KIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 K KIQA KK++E A E E+ + R +Q+K Sbjct: 323 AEKQQKKDAKIQAKKKQEEDAAIAAEEEKRRKEEEEKRAAESAQQQK 369 >At2g22795.1 68415.m02704 expressed protein Length = 734 Score = 28.7 bits (61), Expect = 3.8 Identities = 21/102 (20%), Positives = 49/102 (48%), Gaps = 2/102 (1%) Frame = +3 Query: 324 DQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEE--EYISN 497 ++++K S Q++++ + E +T + + QEE + + + A QEE E + Sbjct: 545 EKIEKEEASSQEESK--ENETETKEKEESSSQEETKEKENEKIEKEESAPQEETKEKENE 602 Query: 498 TLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 + K+ A ++E + + +EE +N+ +N ++K Sbjct: 603 KIEKEESASQEETKEKETETKEKEESSSNESQENVNTESEKK 644 Score = 27.9 bits (59), Expect = 6.6 Identities = 18/87 (20%), Positives = 35/87 (40%) Frame = +3 Query: 312 TVSRDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYI 491 T ++ K E Q + + E +T + QEE + + + + QEE Sbjct: 501 TKEKEDETKEKEESSSQEKTEEKETETKDNEESSSQEETKDKENEKIEKEEASSQEESKE 560 Query: 492 SNTLLKKIQALKKEKETLAHHYEREEE 572 + T K+ + ++ET E+ E+ Sbjct: 561 NETETKEKEESSSQEETKEKENEKIEK 587 >At1g55250.1 68414.m06310 expressed protein weak similarity to PUMA1 [Parascaris univalens] GI:3068590 Length = 522 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/56 (25%), Positives = 34/56 (60%), Gaps = 2/56 (3%) Frame = +3 Query: 381 ELDTYKLRVKALQEENRSL--RQASVSIQAKAEQEEEYISNTLLKKIQALKKEKET 542 ELD YK+ +A+Q E + R ++++A++ + + + T+ +I+ L+K+ ++ Sbjct: 393 ELDRYKILTEAIQAERSFVMRRDKELNLRAESLEAANHKTTTVGSRIEVLEKKLQS 448 >At5g16020.1 68418.m01873 stress protein-related contains weak similarity to Swiss-Prot:P18899 stress protein (DNA damage-responsive protein 48) (DDRP 48) (YP 75) (Flocculent specific protein) [Saccharomyces cerevisiae] Length = 641 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 184 MSKFRFNYQ*KLYFFTRNYYCIFFSNIKHYYDQIFNKK 71 M FRF Y +FF ++ +FFS + DQ KK Sbjct: 1 MVAFRFVYIPLPFFFFFFFFFVFFSGVSQLQDQTATKK 38 >At5g13340.1 68418.m01535 expressed protein Length = 242 Score = 28.3 bits (60), Expect = 5.0 Identities = 25/95 (26%), Positives = 49/95 (51%), Gaps = 2/95 (2%) Frame = +3 Query: 351 LQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQ--EEEYISNTLLKKIQAL 524 LQ + + ++E +T + R++ +N R + ++ + E+ +E Y L +IQ L Sbjct: 83 LQHEAELKRLEEETAQ-RIEEAVRKNVEERMKTEEVKEEIERRTKEAYEKMFLDVEIQ-L 140 Query: 525 KKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCR 629 KKEKE + R+EE + +L+++ +E R Sbjct: 141 KKEKEAALNEARRKEEQARRE-REELDKMLEENSR 174 >At4g27980.1 68417.m04014 expressed protein Length = 565 Score = 28.3 bits (60), Expect = 5.0 Identities = 29/100 (29%), Positives = 47/100 (47%), Gaps = 9/100 (9%) Frame = +3 Query: 348 SLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQA-- 521 SLQ + V +E +LRV ++E+ L + S+S + +E+E I L I+A Sbjct: 38 SLQFDDVVASLEKKEERLRVVEMKEKEIGLLEESISRRLSVLEEKE-IETDLRLVIEASI 96 Query: 522 ----LKKEKETLAHHYEREEECL---TNDLSRKLNQLRQE 620 L+K+ E L + EE L ++KL +L E Sbjct: 97 MRLVLEKQSEDLVTQLKTEENKLGLFLRSTTKKLEELVSE 136 >At3g28370.1 68416.m03545 expressed protein Length = 292 Score = 28.3 bits (60), Expect = 5.0 Identities = 25/95 (26%), Positives = 49/95 (51%), Gaps = 8/95 (8%) Frame = +3 Query: 330 LQKRIESLQQQNRVLKVELDTYKLRVKALQEE-------NRSLRQASV-SIQAKAEQEEE 485 L+KRIE LQ + E++ K R+K + EE SL A++ S++A+ ++ Sbjct: 31 LKKRIEILQSEVEAANSEVEKAK-RIKEVAEEELNGYEVELSLNDATIQSLEARISLLQD 89 Query: 486 YISNTLLKKIQALKKEKETLAHHYEREEECLTNDL 590 ++ T+ ++ ALK ++ L + + E L ++ Sbjct: 90 EVT-TIGSEVDALKNKEGLLRDQFISQMEELNKEI 123 >At1g65010.1 68414.m07368 expressed protein similar to endosome-associated protein (GI:1016368) [Homo sapiens]; similar to Centromeric protein E (CENP-E protein) (Swiss-Prot:Q02224) [Homo sapiens] Length = 1318 Score = 28.3 bits (60), Expect = 5.0 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 2/72 (2%) Frame = +3 Query: 336 KRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLK-- 509 K+I+ L N L + ++ + EEN+ LR+ ++ KAE+ E + + K Sbjct: 807 KKIDELSTANGTLADNVTN----LQNISEENKELRERETTLLKKAEELSELNESLVDKAS 862 Query: 510 KIQALKKEKETL 545 K+Q + +E E L Sbjct: 863 KLQTVVQENEEL 874 >At1g20400.1 68414.m02544 myosin heavy chain-related Length = 944 Score = 28.3 bits (60), Expect = 5.0 Identities = 16/63 (25%), Positives = 31/63 (49%) Frame = +3 Query: 297 MLPPSTVSRDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQ 476 ++P RD L+ +E + + K + D + L K L+EE+ + + +AE+ Sbjct: 855 LMPRLIADRDALKAEVEGFEI-TEIEKDDFDVWTLFEKVLEEEHFEPSASGGHSETEAEK 913 Query: 477 EEE 485 +EE Sbjct: 914 DEE 916 >At1g08730.1 68414.m00969 myosin heavy chain (PCR43) identical to myosin heavy chain PCR43 (PIR:T00727) [Arabidopsis thaliana]; similar to ESTs gb|R30087 and gb|AA394762 Length = 1538 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/47 (27%), Positives = 28/47 (59%) Frame = +3 Query: 318 SRDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSI 458 S + +K++E +++ + L+ L + + L+ EN+ LRQ +VS+ Sbjct: 1017 SLEDKKKKLEETEKKGQQLQESLTRMEEKCSNLESENKVLRQQAVSM 1063 >At5g44180.1 68418.m05406 homeobox transcription factor, putative similar to homeobox transcription factor Hox7/homeotic protein Hox7 (GI:19486) {Lycopersicon peruvianum}; similar to GP|4165087| Williams-Beuren syndrome deletion transcript 9 [Homo sapiens]; contains Pfam PF02791: DDT domain and Pfam PF00046: Homeobox domain Length = 1694 Score = 27.9 bits (59), Expect = 6.6 Identities = 25/100 (25%), Positives = 48/100 (48%) Frame = +3 Query: 324 DQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTL 503 D LQ ++ R+ + E++ ++ R++ E+ LR+ + EE I + Sbjct: 320 DALQLERHRKNEEARIAR-EVEAHEKRIRRELEKQDMLRR----------KREEQIRKEM 368 Query: 504 LKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 ++ + +KE+E L +REEE + R+L R+EK Sbjct: 369 ERQDRERRKEEERLLREKQREEERYLKEQMRELQ--RREK 406 >At4g37820.1 68417.m05351 expressed protein Kaposi's sarcoma-associated herpes-like virus ORF73gene, Kaposi's sarcoma-associated herpesvirus, U52064 Length = 532 Score = 27.9 bits (59), Expect = 6.6 Identities = 22/97 (22%), Positives = 44/97 (45%) Frame = +3 Query: 333 QKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKK 512 +K+ E Q + E + + + QEE++ + +A + QEE I T +K+ Sbjct: 336 RKKKEESSSQGEGKEEEPEKREKEDSSSQEESKEEEPENKEKEASSSQEENEIKETEIKE 395 Query: 513 IQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 K+E + + +E E +++ RK N ++K Sbjct: 396 ----KEESSSQEGNENKETEKKSSESQRKENTNSEKK 428 >At4g02570.1 68417.m00351 cullin family protein similar to cullin 3 [Homo sapiens] GI:3639052; contains Pfam profile PF00888: Cullin family Length = 738 Score = 27.9 bits (59), Expect = 6.6 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 8/89 (8%) Frame = +3 Query: 330 LQKRIESLQQQNRVLKVELDTYKL----RVKALQEENRS--LRQASVSIQAKAEQ--EEE 485 + K E Q +LK LD Y +++ +E+ S L+ S KA +E+ Sbjct: 156 VDKEREGEQIDRALLKNVLDIYVEIGMGQMERYEEDFESFMLQDTSSYYSRKASSWIQED 215 Query: 486 YISNTLLKKIQALKKEKETLAHHYEREEE 572 + +LK + LKKE+E +AH+ E Sbjct: 216 SCPDYMLKSEECLKKERERVAHYLHSSSE 244 >At3g22790.1 68416.m02873 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1694 Score = 27.9 bits (59), Expect = 6.6 Identities = 25/102 (24%), Positives = 46/102 (45%), Gaps = 3/102 (2%) Frame = +3 Query: 330 LQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAE---QEEEYISNT 500 LQK IE L+Q+N L +E Y ++ L ++ Q +AE E + Sbjct: 830 LQKFIEDLEQKNFSLLIECQKYAEASSFSEKLIAELESENLEQQMEAEFLVHEIDNFRGA 889 Query: 501 LLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKC 626 + + +AL+ E + + +E + +SR L ++ + KC Sbjct: 890 ICQVFKALQVEADCKTADQKIAKERI--PVSRVLGEINELKC 929 >At1g54560.1 68414.m06222 myosin, putative similar to myosin GI:433663 from [Arabidopsis thaliana] Length = 1529 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/47 (27%), Positives = 28/47 (59%) Frame = +3 Query: 318 SRDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSI 458 S + +K++E +++ + L+ + + + L+ EN+ LRQ +VSI Sbjct: 1012 SSEDRKKKLEDTEKKAQQLQESVTRLEEKCNNLESENKVLRQQAVSI 1058 >At1g07120.1 68414.m00757 expressed protein Length = 392 Score = 27.9 bits (59), Expect = 6.6 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 3/76 (3%) Frame = +3 Query: 366 RVLKVELDTYKLRVKALQEENRSLRQASVSIQAKA---EQEEEYISNTLLKKIQALKKEK 536 R++K EL Y +R L++EN LRQ ++A+ + E + L KK+Q+ Sbjct: 13 RLVK-ELQAYLVRNDKLEKENHELRQEVARLRAQVSNLKSHENERKSMLWKKLQSSYDGS 71 Query: 537 ETLAHHYEREEECLTN 584 T + + E +N Sbjct: 72 NTDGSNLKAPESVKSN 87 >At4g32610.1 68417.m04643 mitochondrial glycoprotein family protein / MAM33 family protein low similarity to SP|P40513 Mitochondrial acidic protein MAM33, mitochondrial precursor {Saccharomyces cerevisiae}; contains Pfam profile PF02330: Mitochondrial glycoprotein Length = 557 Score = 27.5 bits (58), Expect = 8.8 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 3/52 (5%) Frame = +3 Query: 396 KLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTL---LKKIQALKKEKET 542 K + K L+E ++ S + AEQEE S + LKKI ++KK+K + Sbjct: 226 KDKQKELKESQSEVKSNSDAASESAEQEESSSSIDVKERLKKIASMKKKKSS 277 >At4g14350.2 68417.m02211 protein kinase family protein contains similarity to Swiss-Prot:O13310 serine/threonine-protein kinase orb6 [Schizosaccharomyces pombe] Length = 551 Score = 27.5 bits (58), Expect = 8.8 Identities = 19/76 (25%), Positives = 34/76 (44%) Frame = +3 Query: 306 PSTVSRDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEE 485 P T ++ I + L +E + YK+++++LQE + + A EEE Sbjct: 33 PKTAGGEEALSNITKEKAAAAKLYIE-NHYKMQMQSLQERKERRKMLEKKLAAAEVSEEE 91 Query: 486 YISNTLLKKIQALKKE 533 N LLK ++ + E Sbjct: 92 --QNNLLKDLEMKETE 105 >At4g14350.1 68417.m02210 protein kinase family protein contains similarity to Swiss-Prot:O13310 serine/threonine-protein kinase orb6 [Schizosaccharomyces pombe] Length = 551 Score = 27.5 bits (58), Expect = 8.8 Identities = 19/76 (25%), Positives = 34/76 (44%) Frame = +3 Query: 306 PSTVSRDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEE 485 P T ++ I + L +E + YK+++++LQE + + A EEE Sbjct: 33 PKTAGGEEALSNITKEKAAAAKLYIE-NHYKMQMQSLQERKERRKMLEKKLAAAEVSEEE 91 Query: 486 YISNTLLKKIQALKKE 533 N LLK ++ + E Sbjct: 92 --QNNLLKDLEMKETE 105 >At3g10880.1 68416.m01310 hypothetical protein Length = 278 Score = 27.5 bits (58), Expect = 8.8 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 1/77 (1%) Frame = +3 Query: 315 VSRDQLQKRIESLQQ-QNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYI 491 VS ++ K +E L + +N K++ D + +L+ E RS R+ + EQ EEY+ Sbjct: 160 VSEAEVSKLMEMLSECKNEKSKLQTDNADDLLDSLRAELRS-REIQI------EQMEEYL 212 Query: 492 SNTLLKKIQALKKEKET 542 + L +K E ET Sbjct: 213 NQVLCLNETEIKSESET 229 >At3g02930.1 68416.m00288 expressed protein ; expression supported by MPSS Length = 806 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/70 (20%), Positives = 39/70 (55%) Frame = +3 Query: 330 LQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLK 509 ++ I L+++ +L++ + + K+ ++ +++ + S + +AE+ + + + Sbjct: 353 MESEITDLKEKIELLEMTVASQKVDLEKSEQKLGIAEEESSKSEKEAEKLKNELETVNEE 412 Query: 510 KIQALKKEKE 539 K QALKKE++ Sbjct: 413 KTQALKKEQD 422 >At1g67230.1 68414.m07652 expressed protein Length = 1132 Score = 27.5 bits (58), Expect = 8.8 Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 19/119 (15%) Frame = +3 Query: 324 DQLQKRIESL---QQQNRVLKVELDTYKLRVKALQE-----ENRSLRQASVSIQAK---- 467 D + RI+ L +Q+ VLK ++T ++ALQE E +++Q QAK Sbjct: 293 DDVSSRIKDLALREQETDVLKKSIETKARELQALQEKLEAREKMAVQQLVDEHQAKLDST 352 Query: 468 -------AEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 623 EQ+ + I ++L K+ ++K +E H E + L RKL + ++++ Sbjct: 353 QREFELEMEQKRKSIDDSLKSKVAEVEK-REAEWKHMEEKVAKREQALDRKLEKHKEKE 410 >At1g56040.1 68414.m06434 U-box domain-containing protein contains Pfam profile PF04564: U-box domain Length = 437 Score = 27.5 bits (58), Expect = 8.8 Identities = 24/106 (22%), Positives = 55/106 (51%), Gaps = 9/106 (8%) Frame = +3 Query: 330 LQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQ-EEEYISNTLL 506 L+ ++E+ + + + L + R++ ++ + ++ + + KAE+ E +Y +L Sbjct: 193 LEHKLEAELRHRKETETLLAIERDRIEKVKIQLETVENEIDNTRLKAEEFERKYEGEMIL 252 Query: 507 KKIQ--ALKKEKETLAH------HYEREEECLTNDLSRKLNQLRQE 620 ++ AL+KEK+ L YERE+E L++++ ++ QE Sbjct: 253 RRESEIALEKEKKELEEVKLKLETYEREQENLSSEVRTWQDKYEQE 298 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,343,019 Number of Sequences: 28952 Number of extensions: 220013 Number of successful extensions: 962 Number of sequences better than 10.0: 78 Number of HSP's better than 10.0 without gapping: 882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 953 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -