BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10f19 (467 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0403 - 22622014-22622075,22622159-22622350,22624834-226249... 48 5e-06 04_04_0192 - 23471346-23471572,23473004-23473195,23474342-234744... 46 2e-05 01_01_1089 - 8560008-8560220,8560456-8560977,8561095-8561283,856... 40 0.001 08_01_0357 + 3140610-3140612,3140742-3140900,3141027-3141068 36 0.016 11_01_0710 - 5830475-5830595,5831498-5834124 29 1.9 11_06_0660 - 26005210-26006150,26006440-26006467,26007307-260078... 28 4.3 10_02_0148 - 5859664-5859828,5859916-5860043,5860310-5860451,586... 27 5.7 02_05_1150 + 34481965-34482076,34482174-34482268,34482380-344824... 27 5.7 01_06_1550 + 38191957-38192054,38193084-38193284,38193456-381940... 27 5.7 11_06_0442 - 23622633-23623000,23623149-23623721,23624795-236253... 27 7.5 01_05_0024 - 17262504-17263308,17264251-17264399,17264879-172649... 27 7.5 11_06_0667 + 26071774-26072070,26072352-26073153,26073209-260734... 27 10.0 06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700,336... 27 10.0 05_06_0062 - 25276994-25277089,25277374-25277448,25281149-252812... 27 10.0 05_01_0460 - 3644229-3644420,3644623-3644865,3644959-3645237,364... 27 10.0 04_03_0736 - 19145428-19145474,19145608-19145721,19146707-191478... 27 10.0 >02_04_0403 - 22622014-22622075,22622159-22622350,22624834-22624910, 22625026-22625039 Length = 114 Score = 47.6 bits (108), Expect = 5e-06 Identities = 28/83 (33%), Positives = 43/83 (51%), Gaps = 1/83 (1%) Frame = +1 Query: 193 LQGKNVTVDLRNDTYVCGLIELVDGFMNISFKNAIYCDPQGNEFAFDNLFIHGRNIRYVH 372 L + VT++L+N T V G I VD MN K N FD+L + G NIRY Sbjct: 10 LNNETVTIELKNGTTVHGTITGVDISMNTHLKTVKLTLKGKNPVTFDHLSVRGNNIRYYI 69 Query: 373 IPENMSLLSTIRHEVSK-KFYKP 438 +P++++L + + + + K KP Sbjct: 70 LPDSLNLETLLVEDTPRVKAKKP 92 >04_04_0192 - 23471346-23471572,23473004-23473195,23474342-23474418, 23475810-23475850,23475928-23475974,23476108-23476194, 23476807-23477011,23477747-23477866 Length = 331 Score = 45.6 bits (103), Expect = 2e-05 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 1/83 (1%) Frame = +1 Query: 193 LQGKNVTVDLRNDTYVCGLIELVDGFMNISFKNAIYCDPQGNEFAFDNLFIHGRNIRYVH 372 L + VT++L+N T V G I VD MN K N D+L + G NIRY Sbjct: 172 LNNETVTIELKNGTVVHGTITGVDISMNTHLKTVKLTLKGKNPVTLDHLSVRGNNIRYYI 231 Query: 373 IPENMSLLSTIRHEVSK-KFYKP 438 +P++++L + + + + K KP Sbjct: 232 LPDSLNLETLLVEDTPRVKAKKP 254 >01_01_1089 - 8560008-8560220,8560456-8560977,8561095-8561283, 8561377-8561642,8561967-8562111,8562411-8562530, 8562611-8562930,8564161-8564341,8564434-8564580, 8565186-8565497,8566303-8566450,8566592-8566765, 8567385-8567446,8567499-8567571,8567628-8567683, 8568370-8568645,8569541-8569588,8569870-8569991, 8570258-8570413,8571037-8571079,8572624-8572701, 8572972-8573070,8573168-8573209,8573302-8573304 Length = 1264 Score = 39.9 bits (89), Expect = 0.001 Identities = 22/84 (26%), Positives = 42/84 (50%), Gaps = 1/84 (1%) Frame = +1 Query: 175 LCVVNSLQGKNVTVDLRNDTYVCGLIELVDGFMNISFKNAIYCDPQGNEF-AFDNLFIHG 351 L ++ + QG + V+L+N G + D +MNI + I G++F +I G Sbjct: 4 LSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDKFWRMPECYIRG 63 Query: 352 RNIRYVHIPENMSLLSTIRHEVSK 423 I+Y+ +P+ ++ ++ E SK Sbjct: 64 NTIKYLRVPD--EVIDKVQEETSK 85 >08_01_0357 + 3140610-3140612,3140742-3140900,3141027-3141068 Length = 67 Score = 35.9 bits (79), Expect = 0.016 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +1 Query: 193 LQGKNVTVDLRNDTYVCGLIELVDGFMNISFKNAIYCD 306 L GK VTV+L+ND + G + VD ++NI +N D Sbjct: 10 LVGKEVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVD 47 >11_01_0710 - 5830475-5830595,5831498-5834124 Length = 915 Score = 29.1 bits (62), Expect = 1.9 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +1 Query: 196 QGKN-VTVDLRNDTYVCGLIELVDGFMNISFKNAIYCDPQGNEFAFDNL 339 Q KN V +DL V L E +DG + + N YC GN+F L Sbjct: 239 QLKNLVHLDLSCCNCVKDLSEALDGLAKLQYLNLSYCHHYGNQFRLRGL 287 >11_06_0660 - 26005210-26006150,26006440-26006467,26007307-26007838, 26008863-26009008 Length = 548 Score = 27.9 bits (59), Expect = 4.3 Identities = 8/17 (47%), Positives = 14/17 (82%) Frame = -2 Query: 421 WKLHVELLIGATYFLEY 371 WK+H+E+L+G + +EY Sbjct: 309 WKMHIEILLGVSRAIEY 325 >10_02_0148 - 5859664-5859828,5859916-5860043,5860310-5860451, 5860548-5860643,5860836-5860976,5861799-5861973, 5862416-5862702,5862777-5862870,5863244-5863335, 5863459-5863553,5863648-5863759 Length = 508 Score = 27.5 bits (58), Expect = 5.7 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 370 HIPENMSLLSTIRHEVSKKFYKPHMKQLTEKK 465 H+ L++ I ++S+K YKP K LTE++ Sbjct: 39 HLVVEGLLIAAILFQLSRKSYKPPKKPLTERE 70 >02_05_1150 + 34481965-34482076,34482174-34482268,34482380-34482471, 34482878-34482971,34483191-34483354,34483755-34483929, 34484017-34484157,34484357-34484452,34484549-34484690, 34484953-34485080,34485179-34485343 Length = 467 Score = 27.5 bits (58), Expect = 5.7 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 370 HIPENMSLLSTIRHEVSKKFYKPHMKQLTEKK 465 H+ L++ I ++S+K YKP K LTE++ Sbjct: 39 HLVVEGLLIAAILFQLSRKSYKPPKKPLTERE 70 >01_06_1550 + 38191957-38192054,38193084-38193284,38193456-38194090, 38194398-38195419 Length = 651 Score = 27.5 bits (58), Expect = 5.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 373 IPENMSLLSTIRHEVSKKFYKPHMKQLTEK 462 IP S + ++HE + YKP +K L EK Sbjct: 265 IPNLFSCKNLVKHEGNAWMYKPDLKALREK 294 >11_06_0442 - 23622633-23623000,23623149-23623721,23624795-23625335, 23625807-23625982,23626081-23626804 Length = 793 Score = 27.1 bits (57), Expect = 7.5 Identities = 21/67 (31%), Positives = 34/67 (50%) Frame = +1 Query: 205 NVTVDLRNDTYVCGLIELVDGFMNISFKNAIYCDPQGNEFAFDNLFIHGRNIRYVHIPEN 384 ++T +L C L+E+VD F N S ++ I P + +F I G N +IP + Sbjct: 3 SLTGELPETISSCSLLEIVDLFSN-SIESEI--PPSIGQCSFLQQIILGTNNIRGNIPPD 59 Query: 385 MSLLSTI 405 + LLS + Sbjct: 60 IGLLSNL 66 >01_05_0024 - 17262504-17263308,17264251-17264399,17264879-17264978, 17265829-17265953,17267565-17267743,17269648-17270698 Length = 802 Score = 27.1 bits (57), Expect = 7.5 Identities = 19/69 (27%), Positives = 31/69 (44%) Frame = +1 Query: 136 GTPQEKFFYHNTLLCVVNSLQGKNVTVDLRNDTYVCGLIELVDGFMNISFKNAIYCDPQG 315 G P E + H + + V + +GK ++ + + T + +I N SFKN D G Sbjct: 325 GPPAEVRYQHASSMGAVETRKGKTMSGHIDHSTKIMHVIT-----WNRSFKNLPNQDDFG 379 Query: 316 NEFAFDNLF 342 + F D F Sbjct: 380 DNFEIDERF 388 >11_06_0667 + 26071774-26072070,26072352-26073153,26073209-26073411, 26075078-26075521,26075703-26075758,26076323-26076402, 26077098-26077174,26077279-26078301 Length = 993 Score = 26.6 bits (56), Expect = 10.0 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -2 Query: 445 SYGACRIFWKLHVELLIGATYFLEYAH 365 S+ WK +E+L+G + +EY H Sbjct: 789 SFSPVTASWKTRIEILLGVSRAIEYLH 815 >06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700, 3363820-3364098,3364189-3364386,3364475-3365110, 3365209-3365463,3365579-3365685,3365770-3369566, 3369677-3370166,3370918-3371308,3371481-3371573, 3371687-3371810,3372544-3372791 Length = 2380 Score = 26.6 bits (56), Expect = 10.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +1 Query: 334 NLFIHGRNIRYVHIPENMSL 393 NL IH +N+ Y+H+ N +L Sbjct: 519 NLLIHRKNLNYLHLDYNFNL 538 >05_06_0062 - 25276994-25277089,25277374-25277448,25281149-25281262, 25282220-25282321,25282422-25282519,25282698-25282791, 25282906-25282968,25283253-25283351,25283579-25283722 Length = 294 Score = 26.6 bits (56), Expect = 10.0 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 184 VNSLQGKNVTVDLRNDTYVCGLIELVD-GFMNISFKNAIYCDPQGNEFAFDNLFIHG 351 + LQ ++ LR D Y E D GF+ +S + IY + GN +F+HG Sbjct: 1 MGQLQQQHQEQPLRKDLYP--QTEPYDFGFLKVSGVHTIYYEQSGNPQGHPVVFLHG 55 >05_01_0460 - 3644229-3644420,3644623-3644865,3644959-3645237, 3645328-3645525,3645614-3646249,3646352-3646606, 3646718-3646824,3646909-3650705,3650816-3651305, 3652043-3652433,3652621-3652713,3652818-3652941, 3653871-3654118 Length = 2350 Score = 26.6 bits (56), Expect = 10.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +1 Query: 334 NLFIHGRNIRYVHIPENMSL 393 NL IH +N+ Y+H+ N +L Sbjct: 519 NLLIHRKNLNYLHLDYNFNL 538 >04_03_0736 - 19145428-19145474,19145608-19145721,19146707-19147870, 19150251-19150383 Length = 485 Score = 26.6 bits (56), Expect = 10.0 Identities = 13/43 (30%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +1 Query: 244 GLIELVDGFMNISFKNA-IYCDPQGNEFAFDNLFIHGRNIRYV 369 G++ +DG+MNI+ + Y + Q + + FI G N+ Y+ Sbjct: 433 GILACLDGYMNIAMEQTEEYVNGQLKN-KYGDAFIRGNNVLYI 474 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,364,311 Number of Sequences: 37544 Number of extensions: 217681 Number of successful extensions: 490 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 484 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 490 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 943260316 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -