BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10f15 (717 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 29 0.058 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 29 0.058 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 29 0.058 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 29 0.058 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 29 0.058 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 29 0.058 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 29 0.058 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 29 0.058 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 29 0.058 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 29 0.058 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 28 0.077 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 26 0.31 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 26 0.31 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 26 0.31 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 26 0.31 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 26 0.31 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 23 3.8 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 23 3.8 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 23 3.8 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 23 3.8 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 3.8 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 3.8 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 23 3.8 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 23 3.8 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 6.7 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 8.8 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 8.8 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.058 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 506 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 673 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 674 K 676 + Sbjct: 118 Q 118 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.058 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 506 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 673 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 674 K 676 + Sbjct: 118 Q 118 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.058 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 506 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 673 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 674 K 676 + Sbjct: 118 Q 118 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.058 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 506 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 673 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 674 K 676 + Sbjct: 118 Q 118 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.058 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 506 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 673 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 674 K 676 + Sbjct: 118 Q 118 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.058 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 506 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 673 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 674 K 676 + Sbjct: 118 Q 118 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.058 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 506 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 673 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 674 K 676 + Sbjct: 118 Q 118 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.058 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 506 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 673 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 674 K 676 + Sbjct: 118 Q 118 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 28.7 bits (61), Expect = 0.058 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 506 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 673 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 291 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 350 Query: 674 K 676 + Sbjct: 351 Q 351 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 28.7 bits (61), Expect = 0.058 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 506 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 673 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 291 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 350 Query: 674 K 676 + Sbjct: 351 Q 351 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.3 bits (60), Expect = 0.077 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 506 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 673 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNPLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 674 K 676 + Sbjct: 118 Q 118 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 26.2 bits (55), Expect = 0.31 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +2 Query: 506 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEK 676 +++ K + E++ S E + L N S+YN +N QL +N++E+ Sbjct: 58 KYRKTSKERSRDRTERERSKEPKII---SSLSNNYNYSNYNNNNYKQLCYNINYIEQ 111 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 26.2 bits (55), Expect = 0.31 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +2 Query: 506 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEK 676 +++ K + E++ S E + L N S+YN +N QL +N++E+ Sbjct: 58 KYRKTSKERSRDRTERERSKEPKII---SSLSNNYNYSNYNNNNYKQLCYNINYIEQ 111 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 26.2 bits (55), Expect = 0.31 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +2 Query: 506 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEK 676 +++ K + E++ S E + L N S+YN +N QL +N++E+ Sbjct: 58 KYRKTSKERSRDRTERERSKEPKII---SSLSNNYNYSNYNNNNYKQLCYNINYIEQ 111 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 26.2 bits (55), Expect = 0.31 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +2 Query: 506 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEK 676 +++ K + E++ S E + L N S+YN +N QL +N++E+ Sbjct: 58 KYRKTSKERSRDRTERERSKEPKII---SSLSNNYNYSNYNNNNYKQLCYNINYIEQ 111 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 26.2 bits (55), Expect = 0.31 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +2 Query: 506 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEK 676 +++ K + E++ S E + L N S+YN +N QL +N++E+ Sbjct: 58 KYRKTSKERSRDRTERERSKEPKII---SSLSNNYNYSNYNNNNYKQLCYNINYIEQ 111 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.8 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 494 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 619 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.8 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 494 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 619 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.8 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 494 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 619 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.8 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 494 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 619 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.8 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 494 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 619 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.8 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 494 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 619 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.6 bits (46), Expect = 3.8 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 494 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 619 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.6 bits (46), Expect = 3.8 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 494 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 619 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = +2 Query: 248 LDPKRNTSAVQGSHQHAQAHNEY 316 + P++ Q QH QAH ++ Sbjct: 179 MQPQQGQHQSQAQQQHLQAHEQH 201 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 8.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 545 PEQQSSTETAAVCKNEKLLNKLESS 619 P+ + + T+ K L NKLESS Sbjct: 85 PDSRDRSSTSNTSKTVILSNKLESS 109 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 8.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 545 PEQQSSTETAAVCKNEKLLNKLESS 619 P+ + + T+ K L NKLESS Sbjct: 85 PDSRDRSNTSNTSKTVILSNKLESS 109 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,152 Number of Sequences: 438 Number of extensions: 4611 Number of successful extensions: 31 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -