BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10f10 (713 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8042| Best HMM Match : DUF803 (HMM E-Value=0) 29 3.7 SB_19503| Best HMM Match : Kinesin (HMM E-Value=9.5e-14) 29 4.9 SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) 28 6.5 SB_34401| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 28 8.6 SB_20327| Best HMM Match : LIM (HMM E-Value=4.9e-16) 28 8.6 SB_7260| Best HMM Match : PAN (HMM E-Value=0.00036) 28 8.6 >SB_8042| Best HMM Match : DUF803 (HMM E-Value=0) Length = 603 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -3 Query: 660 IFNTLVFGPIFYFCFTILAHNVIVDLIVFK 571 IFNT + PI+Y FT+L +I I+FK Sbjct: 485 IFNTSLVTPIYYVMFTLL--TIIASAILFK 512 >SB_19503| Best HMM Match : Kinesin (HMM E-Value=9.5e-14) Length = 869 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +3 Query: 135 YTVLKRLSNGFIDKSVDVGSISELQKFNFKINRLTSYISNIFEYEFVVLE 284 YT+ K LS+G+I+ +V S L +N I + N++ LE Sbjct: 36 YTIPKELSDGYINNKREVYKFSVLSGYNGTIFAYGQHPDNVYTVHISYLE 85 >SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) Length = 2059 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 321 TKTKLGHINVSLNQNDPNVLILTVTL 398 TKT L + +NDPNVL +TV L Sbjct: 760 TKTALSTVQCCSLENDPNVLAITVIL 785 >SB_34401| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 2629 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = +3 Query: 129 QNYTVLKRLSNG---FIDKSVDVGSISELQKFNFKINRLTSYISNIFEY 266 QN +V+KRL +G +DK++ +G + + L +++ IFEY Sbjct: 178 QNLSVIKRLGSGNFGHVDKAMAIGIPGFPGQVTVAVKTLKDHLAIIFEY 226 >SB_20327| Best HMM Match : LIM (HMM E-Value=4.9e-16) Length = 339 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 703 LVGIRAIRRQGLRVHIQYT 647 L G+ +RR+G+R H QYT Sbjct: 14 LTGLSDVRREGVRYHYQYT 32 >SB_7260| Best HMM Match : PAN (HMM E-Value=0.00036) Length = 161 Score = 27.9 bits (59), Expect = 8.6 Identities = 20/72 (27%), Positives = 30/72 (41%) Frame = +3 Query: 27 SVVSMCVDNAFAYTTDDLLKNISFSHSKCAPFKLQNYTVLKRLSNGFIDKSVDVGSISEL 206 SV+ V A AY+ DD +KN++ K L + +D S E Sbjct: 17 SVLLSAVQLAHAYSLDDCIKNVNRQFIKTQGKYLHGFKFDTIFVKKPLDCSFKCMDQIEC 76 Query: 207 QKFNFKINRLTS 242 Q FN+++ TS Sbjct: 77 QSFNYQLESSTS 88 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,018,863 Number of Sequences: 59808 Number of extensions: 380466 Number of successful extensions: 1025 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 919 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1024 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -