BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10f10 (713 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 26 1.0 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 24 5.4 AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 23 9.5 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 26.2 bits (55), Expect = 1.0 Identities = 20/65 (30%), Positives = 26/65 (40%) Frame = +1 Query: 430 FYFINTRDNFRDNIAEHVFDMLLERHGSFENYPIVNTAFINSLIVNGFKYNQVDDHVVCE 609 +Y + T N A F + L+R Y NT +N K +VD VCE Sbjct: 1274 YYKMGTERNCFTVTAYRRFKVALKRPAYVVVYDYYNTN------LNAIKVYEVDKQNVCE 1327 Query: 610 YCEAE 624 CE E Sbjct: 1328 ICEEE 1332 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -1 Query: 380 EHVWVVLV*RHVYMAQFSF 324 EH++V L +HV+ A+F F Sbjct: 131 EHIFVALRDQHVFRAKFRF 149 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 23.0 bits (47), Expect = 9.5 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = +3 Query: 90 ISFSHSKCAPF 122 +SF+H +CAPF Sbjct: 490 VSFTHLQCAPF 500 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 691,992 Number of Sequences: 2352 Number of extensions: 13523 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -