BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10f09 (520 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26249| Best HMM Match : No HMM Matches (HMM E-Value=.) 226 1e-59 SB_17063| Best HMM Match : Ribosomal_S17 (HMM E-Value=5.7e-06) 34 0.061 SB_48102| Best HMM Match : Ribosomal_S17 (HMM E-Value=4.2e-34) 33 0.11 SB_8914| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_53154| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_51828| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_15022| Best HMM Match : Zona_pellucida (HMM E-Value=5.6e-38) 28 5.3 SB_39770| Best HMM Match : TolA (HMM E-Value=0.33) 27 7.0 SB_24384| Best HMM Match : I-set (HMM E-Value=4.3e-31) 27 7.0 SB_22900| Best HMM Match : DUF1399 (HMM E-Value=0.00019) 27 7.0 SB_35821| Best HMM Match : TUDOR (HMM E-Value=0) 27 9.3 SB_4587| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 >SB_26249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 226 bits (552), Expect = 1e-59 Identities = 103/155 (66%), Positives = 127/155 (81%), Gaps = 12/155 (7%) Frame = +1 Query: 22 MADQTERSFQKQPTVFLNRKKGIGVKRSRKPLRYHKDVGLGFKTP------------REA 165 MA+QTER++QKQ +F NRK+ +G +K LR+ ++VGLGFKTP REA Sbjct: 1 MAEQTERAYQKQAPIFQNRKRVLGQVTKKKDLRFVRNVGLGFKTPKDVCNCTYLLPEREA 60 Query: 166 IEGTYIDKKCPFTGNVSIRGRILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMS 345 IEGTYIDKKCPFTGNVSIRGRILTG+ + MKM+RTI+IRRDYLHY+ KYNRFEKRH+N++ Sbjct: 61 IEGTYIDKKCPFTGNVSIRGRILTGICRSMKMKRTIIIRRDYLHYIKKYNRFEKRHKNLA 120 Query: 346 VHLSPCFRDVEIGDIVTIGECRPLSKTVRFNVLKV 450 H SPCFRD+ +GD++T+G+CRPLSKTVRFNVLKV Sbjct: 121 AHCSPCFRDIALGDLITVGQCRPLSKTVRFNVLKV 155 >SB_17063| Best HMM Match : Ribosomal_S17 (HMM E-Value=5.7e-06) Length = 73 Score = 34.3 bits (75), Expect = 0.061 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +1 Query: 382 GDIVTIGECRPLSKTVRFNVLKV 450 GD+V I ECRPLSK +FNV ++ Sbjct: 29 GDVVRIKECRPLSKMKKFNVEEI 51 >SB_48102| Best HMM Match : Ribosomal_S17 (HMM E-Value=4.2e-34) Length = 208 Score = 33.5 bits (73), Expect = 0.11 Identities = 22/83 (26%), Positives = 39/83 (46%) Frame = +1 Query: 202 TGNVSIRGRILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHLSPCFRDVEI 381 T + R ++ G+V KM +TI + + P Y + + + H + + Sbjct: 5 TAERTTRRKVREGLVVSDKMNKTITVMVEDRVKHPLYGKVMTKSVRLKAHDEN--NEAGM 62 Query: 382 GDIVTIGECRPLSKTVRFNVLKV 450 GD V I E RPLS T R+ ++++ Sbjct: 63 GDRVRIMETRPLSATKRWRLVEI 85 >SB_8914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1142 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -2 Query: 264 LHLHFLNDAGEDAAADRNVTSEGTLLVNVGTLNRLTG 154 LH+ F D E A N+ S T+++N+ T N++TG Sbjct: 868 LHIDF-GDCFEVTAHLNNINSITTIIINIVTFNKVTG 903 >SB_53154| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 312 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 132 ILVVSQRFSAPLHTNTFLAVQ 70 ILV+ Q F P HTN F+A Q Sbjct: 78 ILVLVQPFPLPYHTNAFIAAQ 98 >SB_51828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 28.3 bits (60), Expect = 4.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 375 HVPEARRQMHGHIPVPFLEP 316 HV +A R HG++P+P L P Sbjct: 82 HVDQACRSFHGNLPLPVLAP 101 >SB_15022| Best HMM Match : Zona_pellucida (HMM E-Value=5.6e-38) Length = 525 Score = 27.9 bits (59), Expect = 5.3 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +1 Query: 229 ILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHLSPCF 366 I+ VV K K + VI RD+ Y ++ +R VH SP F Sbjct: 64 IMNKVVPKEKEDKNKVITRDHQAYFAFSCKYHRRMVLTVVHFSPSF 109 >SB_39770| Best HMM Match : TolA (HMM E-Value=0.33) Length = 732 Score = 27.5 bits (58), Expect = 7.0 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = -2 Query: 441 NIESNCFGQRSAFADRYNIT-NLHVPEARRQMHGHIPVPFLEPIVFG*VVKVIAADHDSS 265 N+ ++ S + YNIT NLH+ E P+P FG + + A D++ S Sbjct: 76 NLMADLSSDGSEVSKTYNITINLHLMEVLSSDGNESPIPRKGTFDFGGMQDIAALDYEES 135 >SB_24384| Best HMM Match : I-set (HMM E-Value=4.3e-31) Length = 1399 Score = 27.5 bits (58), Expect = 7.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 173 PSIASRGVLKPRPTSLWYLNG 111 P++ +GV PRPT WY G Sbjct: 654 PTLQCKGVGDPRPTITWYRKG 674 >SB_22900| Best HMM Match : DUF1399 (HMM E-Value=0.00019) Length = 696 Score = 27.5 bits (58), Expect = 7.0 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = -2 Query: 255 HFLNDAGEDAAADRNVTSEGTLLVNVGTLNRLTGSLETEAHILVVSQRFSAPLH 94 HF +D D A R EG GT+ R L+T ++ Q F++ +H Sbjct: 188 HFCDDNFLDVATQRAFECEGIEYARPGTICRERQPLKTHPSPVIHPQAFASVVH 241 >SB_35821| Best HMM Match : TUDOR (HMM E-Value=0) Length = 754 Score = 27.1 bits (57), Expect = 9.3 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = +1 Query: 82 KGIGVKRSRKPLRYHKDVGLGFKTPREAIEGTYIDKK 192 + + V + + PL H D+ + +K P + Y+DK+ Sbjct: 271 EAVKVFKDKVPLNSHLDIKILYKNPEFLVVDLYVDKE 307 >SB_4587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2656 Score = 27.1 bits (57), Expect = 9.3 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = +1 Query: 82 KGIGVKRSRKPLRYHKDVGLGFKTPREAIEGTYIDKK 192 + + V + + PL H D+ + +K P + Y+DK+ Sbjct: 1552 EAVKVFKDKVPLNSHLDIKILYKNPEFLVVDLYVDKE 1588 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,397,823 Number of Sequences: 59808 Number of extensions: 317335 Number of successful extensions: 806 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1160542895 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -