BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10f08 (710 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC24C6.10c |||conserved eukaryotic protein|Schizosaccharomyces... 28 1.1 SPAC1B3.10c |||SEL1 repeat protein, unknown biological role|Schi... 27 2.0 SPBC18H10.21c ||SPBC9B6.01c|dubious|Schizosaccharomyces pombe|ch... 26 6.1 >SPBC24C6.10c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 374 Score = 28.3 bits (60), Expect = 1.1 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = -2 Query: 571 GFLDLFI-AVYNFGDRSNFVAFDTFHF-YTLIYNIC 470 GF+ + I A+ F DRS VAF +F + L+Y IC Sbjct: 120 GFIPVLIKAMKQFKDRSENVAFTSFRYALFLVYYIC 155 >SPAC1B3.10c |||SEL1 repeat protein, unknown biological role|Schizosaccharomyces pombe|chr 1|||Manual Length = 680 Score = 27.5 bits (58), Expect = 2.0 Identities = 19/71 (26%), Positives = 34/71 (47%) Frame = -3 Query: 684 ISRVLSIAMYLLSANLIFRVS*LSKLLRFFKSNSANS*VFWIFSSLFTISVTVRTLLHLT 505 + R+LSIA +LLS + + R+ + + N+ S V + T SV V+ L + Sbjct: 14 LKRILSIAFFLLSLSTLLRIVNAQQ----YVDNNIGSMVLSDYDFAETPSVRVQRALEIL 69 Query: 504 RFIFIHLSTTF 472 R+ + T+ Sbjct: 70 RYYYEQEDVTY 80 >SPBC18H10.21c ||SPBC9B6.01c|dubious|Schizosaccharomyces pombe|chr 2|||Manual Length = 157 Score = 25.8 bits (54), Expect = 6.1 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 251 NSKHVFDHFGCSSNYCFNNYV 313 N VF+H CS Y FNN V Sbjct: 2 NGLRVFEHVHCSVLYKFNNIV 22 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,546,534 Number of Sequences: 5004 Number of extensions: 46163 Number of successful extensions: 139 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 139 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 331187010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -