BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10f02 (469 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 23 1.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 2.5 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 2.5 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 2.5 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 2.5 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 21 4.3 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 20 9.9 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 23.0 bits (47), Expect = 1.4 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 241 KLSRRQVDFLIHALLN 288 KL+ R +DFL H L N Sbjct: 138 KLAARYIDFLYHVLSN 153 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 2.5 Identities = 10/32 (31%), Positives = 21/32 (65%) Frame = +1 Query: 163 VINMFLNDEIENDKIYKLVETVDSSNKLSRRQ 258 +IN+ + E+ N ++ + +T+D S +SRR+ Sbjct: 1134 LINIADSLEMLNKRLDHIEKTIDPSGHISRRR 1165 Score = 20.6 bits (41), Expect = 7.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 18 VQFNEKLFHRTGQIDNV 68 +QF LFHR G I ++ Sbjct: 1340 IQFVAMLFHRFGTIAHI 1356 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 2.5 Identities = 10/32 (31%), Positives = 21/32 (65%) Frame = +1 Query: 163 VINMFLNDEIENDKIYKLVETVDSSNKLSRRQ 258 +IN+ + E+ N ++ + +T+D S +SRR+ Sbjct: 1134 LINIADSLEMLNKRLDHIEKTIDPSGHISRRR 1165 Score = 20.6 bits (41), Expect = 7.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 18 VQFNEKLFHRTGQIDNV 68 +QF LFHR G I ++ Sbjct: 1340 IQFVAMLFHRFGTIAHI 1356 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 2.5 Identities = 10/32 (31%), Positives = 21/32 (65%) Frame = +1 Query: 163 VINMFLNDEIENDKIYKLVETVDSSNKLSRRQ 258 +IN+ + E+ N ++ + +T+D S +SRR+ Sbjct: 1134 LINIADSLEMLNKRLDHIEKTIDPSGHISRRR 1165 Score = 20.6 bits (41), Expect = 7.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 18 VQFNEKLFHRTGQIDNV 68 +QF LFHR G I ++ Sbjct: 1340 IQFVAMLFHRFGTIAHI 1356 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 2.5 Identities = 10/32 (31%), Positives = 21/32 (65%) Frame = +1 Query: 163 VINMFLNDEIENDKIYKLVETVDSSNKLSRRQ 258 +IN+ + E+ N ++ + +T+D S +SRR+ Sbjct: 1134 LINIADSLEMLNKRLDHIEKTIDPSGHISRRR 1165 Score = 20.6 bits (41), Expect = 7.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 18 VQFNEKLFHRTGQIDNV 68 +QF LFHR G I ++ Sbjct: 1340 IQFVAMLFHRFGTIAHI 1356 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 21.4 bits (43), Expect = 4.3 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -3 Query: 449 QIYFHFYLSYY 417 Q+YF FY +Y+ Sbjct: 151 QLYFQFYYTYF 161 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 20.2 bits (40), Expect = 9.9 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 Query: 27 NEKLFHRTGQIDNVHH*G 80 N+K QIDN+ H G Sbjct: 216 NKKRIEEKSQIDNLFHNG 233 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,155 Number of Sequences: 336 Number of extensions: 1653 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10826639 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -