BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10f02 (469 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57921| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_38872| Best HMM Match : Histone (HMM E-Value=3e-31) 29 2.5 SB_46577| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_46530| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_23788| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38) 27 5.9 SB_57970| Best HMM Match : Histone (HMM E-Value=9.8e-31) 27 7.7 SB_56481| Best HMM Match : Histone (HMM E-Value=8.6e-29) 27 7.7 SB_39197| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_34142| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_32335| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_29672| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_25738| Best HMM Match : Fer4 (HMM E-Value=1.1) 27 7.7 SB_25346| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_24672| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_24338| Best HMM Match : Histone (HMM E-Value=9.7e-28) 27 7.7 SB_23111| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_16864| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_13575| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_11336| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_10189| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_7802| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_4428| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_3228| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_59150| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_51806| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_49903| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_46692| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_40749| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_39962| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_27259| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_25215| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_24392| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_20041| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_18317| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_14748| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_5066| Best HMM Match : Histone (HMM E-Value=9.8e-31) 27 7.7 SB_2687| Best HMM Match : Histone (HMM E-Value=4e-29) 27 7.7 SB_1957| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 >SB_57921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 29.1 bits (62), Expect = 1.9 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = -3 Query: 389 SSFVTRKFAKKLSSSCVKTLSSTNLCNVNVTLTLFNNACIKKST 258 SS ++ FA+ + +CV L NLC+ T + + CI+ T Sbjct: 39 SSLLSSYFARARTKNCVFLLHGRNLCSGQNTTPIMDAWCIRNYT 82 >SB_38872| Best HMM Match : Histone (HMM E-Value=3e-31) Length = 242 Score = 28.7 bits (61), Expect = 2.5 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIEN--DKIYKLVETVDSSNKLSRRQVDFLIHALLNN 291 +QV+PD S K ++N F+ND E + +L + + +S R+V + LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAH-YNKRSTISSREVQTAVRLLLPA 101 Query: 292 VSVTF 306 TF Sbjct: 102 GKTTF 106 >SB_46577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 28.3 bits (60), Expect = 3.4 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = -2 Query: 177 KHVNYSFKF--KRKILVRIDLFAQPIAKSGFDHGHLSGERCRFDQF 46 +HV Y KF +R R+ F + +A+ +DH LSG C +QF Sbjct: 178 EHVQYEHKFDGQRSNGDRMRTF-KAMARVNYDHERLSGGSCDTEQF 222 >SB_46530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 4.4 Identities = 12/43 (27%), Positives = 25/43 (58%) Frame = +1 Query: 154 LKRVINMFLNDEIENDKIYKLVETVDSSNKLSRRQVDFLIHAL 282 L+R+ +F + I N+++YK + N++ R++ +L H L Sbjct: 12 LRRICGIFWPNVISNEELYKNTSSSSLVNQIRYRRLKWLGHVL 54 >SB_23788| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38) Length = 1122 Score = 27.5 bits (58), Expect = 5.9 Identities = 19/56 (33%), Positives = 31/56 (55%) Frame = +1 Query: 199 DKIYKLVETVDSSNKLSRRQVDFLIHALLNNVSVTFTLHRFVDDNVLTQDELSFLA 366 +K+ +++E N S R+ DFL++AL + + + RFV V+T LS LA Sbjct: 35 NKLAQMIEGTALHNTESIRKSDFLVYALCSTLLSSHPACRFV---VVTLHTLSCLA 87 >SB_57970| Best HMM Match : Histone (HMM E-Value=9.8e-31) Length = 118 Score = 27.1 bits (57), Expect = 7.7 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +1 Query: 121 QVYPDKDFSLKLKRVINMFLNDEIEN--DKIYKLVETVDSSNKLSRRQVDFLIHALL 285 QV+PD S K ++N F+ND E + +L + + +S R+V + LL Sbjct: 40 QVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAH-YNKKHTISSREVQTAVRLLL 95 >SB_56481| Best HMM Match : Histone (HMM E-Value=8.6e-29) Length = 125 Score = 27.1 bits (57), Expect = 7.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIE 195 +QV+PD S K ++N F+ND E Sbjct: 46 KQVHPDTGISTKAMGIMNSFVNDIFE 71 >SB_39197| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_34142| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_32335| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_29672| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_25738| Best HMM Match : Fer4 (HMM E-Value=1.1) Length = 241 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 404 NWYASSSFVTRKFAKKLSSSCVKTLSSTNLCNVNVTL 294 NW A + F+++KF K SS + L+ + + NV L Sbjct: 176 NWLALAVFLSKKFRVKKSSYLLVNLTGSVILNVKQQL 212 >SB_25346| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_24672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 27.1 bits (57), Expect = 7.7 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +1 Query: 121 QVYPDKDFSLKLKRVINMFLNDEIEN--DKIYKLVETVDSSNKLSRRQVDFLIHALL 285 QV+PD S K ++N F+ND E + +L + + +S R+V + LL Sbjct: 40 QVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAH-YNKKHTISSREVQTAVRLLL 95 >SB_24338| Best HMM Match : Histone (HMM E-Value=9.7e-28) Length = 100 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_23111| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_16864| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 125 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_13575| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_11336| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 115 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 36 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 92 >SB_10189| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_7802| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_4428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 65 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 121 >SB_3228| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_59150| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_51806| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_49903| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_46692| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 103 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 24 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 80 >SB_40749| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_39962| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 98 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 19 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 75 >SB_27259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 27.1 bits (57), Expect = 7.7 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 154 LKRVINMFLNDEIENDKIYKLVETVDSSNKLSRRQVDFLIHAL 282 L+R+ +F + I N ++YK + N++ R++ +L H L Sbjct: 12 LRRICGIFWPNVISNQELYKNTSSSSLVNQIRYRRLKWLGHVL 54 >SB_25215| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_24392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/63 (25%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = -3 Query: 443 YFHFYLSYY*YAGNWYASSSFVTRKFAKKLSSS-CVKTLSSTNLCNVNVTLTLFNNACIK 267 Y++ Y Y Y G WYA S K+ +S+ ++S +L + ++ T +N+ Sbjct: 205 YYYAYTWLYYYGGYWYARSCSYNNKYLCFVSADHRYPIINSGDLIALEMSYTSGSNSTYT 264 Query: 266 KST 258 + T Sbjct: 265 RCT 267 >SB_20041| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_18317| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_14748| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_5066| Best HMM Match : Histone (HMM E-Value=9.8e-31) Length = 118 Score = 27.1 bits (57), Expect = 7.7 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +1 Query: 121 QVYPDKDFSLKLKRVINMFLNDEIEN--DKIYKLVETVDSSNKLSRRQVDFLIHALL 285 QV+PD S K ++N F+ND E + +L + + +S R+V + LL Sbjct: 40 QVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAH-YNKKHTISSREVQTAVRLLL 95 >SB_2687| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIENDKI-YKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + + + +S R++ I LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 >SB_1957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 27.1 bits (57), Expect = 7.7 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +1 Query: 118 EQVYPDKDFSLKLKRVINMFLNDEIEN--DKIYKLVETVDSSNKLSRRQVDFLIHALL 285 +QV+PD S K ++N F+ND E + +L + + +S R+V + LL Sbjct: 43 KQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAH-YNKRSTISSREVQTAVRLLL 99 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,752,513 Number of Sequences: 59808 Number of extensions: 201261 Number of successful extensions: 618 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 583 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 969807871 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -