BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10e20 (550 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g00100.1 68417.m00010 40S ribosomal protein S13 (RPS13A) simi... 246 8e-66 At3g60770.1 68416.m06798 40S ribosomal protein S13 (RPS13A) AtRP... 245 1e-65 At3g07990.1 68416.m00976 serine carboxypeptidase S10 family prot... 31 0.67 At1g65720.1 68414.m07459 expressed protein 30 0.89 At5g50280.1 68418.m06226 pentatricopeptide (PPR) repeat-containi... 28 4.7 At4g17570.1 68417.m02627 zinc finger (GATA type) family protein 28 4.7 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 28 4.7 At2g28340.1 68415.m03444 zinc finger (GATA type) family protein ... 28 4.7 At3g13150.1 68416.m01645 pentatricopeptide (PPR) repeat-containi... 27 6.2 At1g42440.1 68414.m04894 expressed protein contains Pfam domain,... 27 6.2 At5g43930.1 68418.m05374 transducin family protein / WD-40 repea... 27 8.3 At5g20300.1 68418.m02416 chloroplast outer membrane protein, put... 27 8.3 At2g38000.1 68415.m04664 chaperone protein dnaJ-related weak sim... 27 8.3 At1g01320.1 68414.m00048 tetratricopeptide repeat (TPR)-containi... 27 8.3 >At4g00100.1 68417.m00010 40S ribosomal protein S13 (RPS13A) similar to ribosomal protein S13; PF00312 (View Sanger Pfam): ribosomal protein S15; identical to cDNA AtRPS13A mRNA for cytoplasmic ribosomal protein S13 GI:6521011 Length = 151 Score = 246 bits (602), Expect = 8e-66 Identities = 117/151 (77%), Positives = 130/151 (86%) Frame = +1 Query: 61 MGRMHAPGKGISQSALPYRRSVPTWXKLTADDVKEQIYKLGKKGLTPSQIGVMLRDSHGV 240 MGRMH+ GKGIS SALPY+RS P+W K T+ DV E I K KKGLTPSQIGV+LRDSHG+ Sbjct: 1 MGRMHSRGKGISASALPYKRSSPSWLKTTSQDVDESICKFAKKGLTPSQIGVILRDSHGI 60 Query: 241 AQVRFVTGKKILRIMKAMGLAPDLPEDLYYLIKKAVAMRKHLERNRKDKDSKFRLILVES 420 QV+ VTG KILRI+KA GLAP++PEDLY+LIKKAVA+RKHLERNRKDKDSKFRLILVES Sbjct: 61 PQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLERNRKDKDSKFRLILVES 120 Query: 421 RIHRLARYYKTKSVLPPNWKYESSTASALVA 513 RIHRLARYYK LPP WKYES+TAS LVA Sbjct: 121 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 151 >At3g60770.1 68416.m06798 40S ribosomal protein S13 (RPS13A) AtRPS13A mRNA for cytoplasmic ribosomal protein S13, Arabidopsis thaliana,AB031739 Length = 151 Score = 245 bits (600), Expect = 1e-65 Identities = 117/151 (77%), Positives = 129/151 (85%) Frame = +1 Query: 61 MGRMHAPGKGISQSALPYRRSVPTWXKLTADDVKEQIYKLGKKGLTPSQIGVMLRDSHGV 240 MGRMH+ GKGIS SALPY+RS P+W K T DV E I K KKGLTPSQIGV+LRDSHG+ Sbjct: 1 MGRMHSRGKGISASALPYKRSSPSWLKTTPQDVDESICKFAKKGLTPSQIGVILRDSHGI 60 Query: 241 AQVRFVTGKKILRIMKAMGLAPDLPEDLYYLIKKAVAMRKHLERNRKDKDSKFRLILVES 420 QV+ VTG KILRI+KA GLAP++PEDLY+LIKKAVA+RKHLERNRKDKDSKFRLILVES Sbjct: 61 PQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLERNRKDKDSKFRLILVES 120 Query: 421 RIHRLARYYKTKSVLPPNWKYESSTASALVA 513 RIHRLARYYK LPP WKYES+TAS LVA Sbjct: 121 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 151 >At3g07990.1 68416.m00976 serine carboxypeptidase S10 family protein similar to serine carboxypeptidase II (CP-MII) GB:CAA70815 [Hordeum vulgare] Length = 459 Score = 30.7 bits (66), Expect = 0.67 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 97 GRYPYQERAYDPCLRLFT 44 GRYP+ RAYDPC ++ Sbjct: 300 GRYPWMSRAYDPCTERYS 317 >At1g65720.1 68414.m07459 expressed protein Length = 180 Score = 30.3 bits (65), Expect = 0.89 Identities = 19/52 (36%), Positives = 28/52 (53%) Frame = -3 Query: 269 FLPVTNLTWATPCESLSITPICEGVRPFFPSL*ICSFTSSAVNFXQVGTLRR 114 FL +T +T A PC++ I+ + P P+L FTS+ F V T+RR Sbjct: 16 FLSITTITTARPCKTFLISSYSLSITPENPNL-ESDFTST--RFVTVFTIRR 64 >At5g50280.1 68418.m06226 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 723 Score = 27.9 bits (59), Expect = 4.7 Identities = 24/88 (27%), Positives = 41/88 (46%) Frame = +1 Query: 241 AQVRFVTGKKILRIMKAMGLAPDLPEDLYYLIKKAVAMRKHLERNRKDKDSKFRLILVES 420 A VR K+ K M + +P+ Y +A+ K +NRKDK + L ++ S Sbjct: 634 AFVRVRDFKRAFFYHKMMVKSGQVPDPRSYEKLRAILEDKAKTKNRKDKTA--ILGIINS 691 Query: 421 RIHRLARYYKTKSVLPPNWKYESSTASA 504 + R+ KTK WKY+++ ++ Sbjct: 692 KFGRVKA--KTKGKKDEFWKYKTNRTTS 717 >At4g17570.1 68417.m02627 zinc finger (GATA type) family protein Length = 510 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = +3 Query: 147 CRRCKGTNLQTWKEGSHSLTNWCNAEGFTWSCPSKIRNW 263 C C TN W+ G CNA G W + N+ Sbjct: 7 CYHCGVTNTPLWRNGPPEKPVLCNACGSRWRTKGTLVNY 45 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -3 Query: 308 SGARPIAFMIRRIFLPVTNLTWATPCESLSITP 210 + R I +++RR+ LP+ N + PC L+ P Sbjct: 212 ASGRQITWLLRRLTLPIRNALFEEPCLFLNSHP 244 >At2g28340.1 68415.m03444 zinc finger (GATA type) family protein and genefinder Length = 315 Score = 27.9 bits (59), Expect = 4.7 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 141 IDCRRCKGTNLQTWKEGSHSLTNWCNAEG 227 + C C+ T W+EG + CNA G Sbjct: 215 LKCTHCETTTTPQWREGPNGRKTLCNACG 243 >At3g13150.1 68416.m01645 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 551 Score = 27.5 bits (58), Expect = 6.2 Identities = 19/76 (25%), Positives = 32/76 (42%), Gaps = 1/76 (1%) Frame = +1 Query: 88 GISQSALPYRRSVPTWX-KLTADDVKEQIYKLGKKGLTPSQIGVMLRDSHGVAQVRFVTG 264 GI+ + Y + K + DD+ +L K G P I + FV G Sbjct: 188 GITPDLVTYNTMIKALCRKGSMDDILSIFEELEKNGFEPDLISFNTLLEEFYRRELFVEG 247 Query: 265 KKILRIMKAMGLAPDL 312 +I +MK+ L+P++ Sbjct: 248 DRIWDLMKSKNLSPNI 263 >At1g42440.1 68414.m04894 expressed protein contains Pfam domain, PF04950: Protein of unknown function (DUF663) Length = 793 Score = 27.5 bits (58), Expect = 6.2 Identities = 22/95 (23%), Positives = 42/95 (44%), Gaps = 5/95 (5%) Frame = +1 Query: 262 GKKILRIMKAMGLAPD--LPEDLYYLIKKAVAMRKHLERNRKDK---DSKFRLILVESRI 426 G + L + +++GL L DL +KK M+K + D KF + Sbjct: 170 GSQCLSVFRSIGLPSTTVLIRDLPSDVKKKNEMKKMCASQLASEFPEDCKFYPADTRDEL 229 Query: 427 HRLARYYKTKSVLPPNWKYESSTASALVA*VLINN 531 H+ +K + + P+W+ + S A A +L+++ Sbjct: 230 HKFMWLFKAQRLTVPHWRSQRSYIVARKAGMLVDD 264 >At5g43930.1 68418.m05374 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to WD-repeat protein 5 (SP:Q9UGP9) [Homo sapiens] Length = 726 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 162 GTNLQTWKEGSHSLTNWCNAE 224 GTN ++ KE SLT+W AE Sbjct: 70 GTNNESMKETGQSLTSWVEAE 90 >At5g20300.1 68418.m02416 chloroplast outer membrane protein, putative similar to chloroplast protein import component Toc159 [Pisum sativum] GI:8489806, chloroplast outer envelope protein 86 [Pisum sativum] GI:599958, GTP-binding protein [Pisum sativum] GI:576509 Length = 793 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -2 Query: 261 SYESYLGNSM*IPQHYTNL*GSETLLSKFVNL 166 +YESY+G M + QHY + S+T L V L Sbjct: 308 NYESYVGQRMDVVQHYIHQAVSDTKLENPVLL 339 >At2g38000.1 68415.m04664 chaperone protein dnaJ-related weak similarity to Chaperone protein dnaJ (Swiss-Prot:Q9ZFC5) [Methylovorus sp.] Length = 419 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 147 CRRCKGTNLQTWKEGSHSLTNWCNAEGFTWSCPS 248 C C G L K+GS ++ CN +G CP+ Sbjct: 232 CSTCYGRGLVAHKDGSDTICTNCNGKG-KLPCPT 264 >At1g01320.1 68414.m00048 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|P46825 Kinesin light chain (KLC) {Loligo pealeii}; contains Pfam profile PF00515: TPR Domain Length = 1797 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/64 (28%), Positives = 27/64 (42%) Frame = +3 Query: 60 HGSYARSW*GYLPVGAALPPQCPYLVEIDCRRCKGTNLQTWKEGSHSLTNWCNAEGFTWS 239 +G A +W +P AA P + ++ R G ++GS+ L W N F S Sbjct: 278 YGFRANTW--LIPPTAAQSPAAFPPLPVEDERWGGDGGGQGRDGSYDLVPWSNEFAFIAS 335 Query: 240 CPSK 251 P K Sbjct: 336 MPCK 339 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,296,228 Number of Sequences: 28952 Number of extensions: 227427 Number of successful extensions: 659 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 647 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 658 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -