BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10e16 (704 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 23 2.1 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.1 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 23 3.7 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 22 4.9 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 8.6 DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 21 8.6 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 21 8.6 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 21 8.6 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 21 8.6 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 508 KSRLQHAYRHVAVVVFVDQLGQTVFFVSFNRLFI 407 + R + RH+ V ++D++ + VF SF L I Sbjct: 452 RKRGEKIARHINSVSYIDKVARIVFPASFGLLNI 485 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.4 bits (48), Expect = 2.1 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = -3 Query: 174 LNIMRTGFVNCVFIILLMYTNSLVCSST*QSRITVWDTS 58 LN M + V C + LLM TN + + T DT+ Sbjct: 691 LNTMESHEVRCTAVFLLMKTNPPLSMLQRMAEFTKLDTN 729 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -3 Query: 177 MLNIMRTGFVNCVFIILLMYTNSLVC 100 +L+++ GF+ + I L + N LVC Sbjct: 22 LLSVLLVGFLFLILIFLSVAGNILVC 47 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 22.2 bits (45), Expect = 4.9 Identities = 7/27 (25%), Positives = 18/27 (66%) Frame = +2 Query: 212 NDLRDRIKSKVDEQFDQLEREYSDKID 292 ND R R+++ ++ ++ +REY +++ Sbjct: 404 NDARRRVEAALEAVEEERQREYGIRVE 430 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 620 LAYVDSVEFDGKQFEE 667 L YVD+ +F Q+EE Sbjct: 278 LYYVDTEQFSNPQYEE 293 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 181 GSYTKRYAQEQRFARQN 231 G Y KRY +FA+ N Sbjct: 109 GEYKKRYEHGLQFAKNN 125 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.4 bits (43), Expect = 8.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 158 RVLSIACS*SC*CTPTLWFVRPH 90 RV+ CS +C L VRPH Sbjct: 236 RVIPQVCSGNCKLNDILLTVRPH 258 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 181 GSYTKRYAQEQRFARQN 231 G Y KRY +FA+ N Sbjct: 109 GEYKKRYEHGLQFAKNN 125 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.4 bits (43), Expect = 8.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 158 RVLSIACS*SC*CTPTLWFVRPH 90 RV+ CS +C L VRPH Sbjct: 236 RVIPQVCSGNCKLNDILLTVRPH 258 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,506 Number of Sequences: 438 Number of extensions: 3986 Number of successful extensions: 10 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -