BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10e13 (323 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0071 + 26177698-26177796,26178449-26178553,26178636-261787... 27 3.4 07_03_0919 - 22594980-22595111,22595398-22595427,22595522-225955... 27 4.5 04_04_1135 + 31140032-31140043,31140552-31140592,31140680-311407... 27 4.5 >01_06_0071 + 26177698-26177796,26178449-26178553,26178636-26178742, 26179466-26179620,26180140-26180228,26180353-26180875, 26181568-26181642,26181802-26182022,26182657-26182739, 26182826-26182937,26183206-26183280,26183346-26183525 Length = 607 Score = 27.1 bits (57), Expect = 3.4 Identities = 18/42 (42%), Positives = 22/42 (52%) Frame = +1 Query: 16 HCFILQILNMNVSNMTLKISTKNSVS*KLRFCRIYACKCDNN 141 H + LQ L+ N + KIS KNS+ K R I A CD N Sbjct: 261 HVWHLQTLSQN-EVLPTKISVKNSLDKKGRIPIISAKLCDTN 301 >07_03_0919 - 22594980-22595111,22595398-22595427,22595522-22595587, 22596021-22596107,22596868-22596921,22597696-22597762, 22598099-22598215,22598536-22598637,22598784-22598902, 22598966-22599049,22599220-22599354,22599470-22599505, 22599581-22599700,22600557-22600645,22601507-22601596, 22601629-22601802,22602135-22602235,22602323-22602363, 22602872-22602883 Length = 551 Score = 26.6 bits (56), Expect = 4.5 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 217 QKKILNIVKK*QRMVNKYGF 276 ++ L+ VKK QR VN YGF Sbjct: 88 RRNYLHFVKKYQRQVNNYGF 107 >04_04_1135 + 31140032-31140043,31140552-31140592,31140680-31140780, 31141113-31141419,31141565-31141661 Length = 185 Score = 26.6 bits (56), Expect = 4.5 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 217 QKKILNIVKK*QRMVNKYGF 276 ++ L+ VKK QR VN YGF Sbjct: 88 RRNYLHFVKKYQRQVNNYGF 107 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,878,733 Number of Sequences: 37544 Number of extensions: 115708 Number of successful extensions: 229 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 215 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 223 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 423156300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -