BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10e11 (702 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39358| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_458| Best HMM Match : DUF19 (HMM E-Value=1.5) 30 2.1 >SB_39358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 30.3 bits (65), Expect = 1.6 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +2 Query: 485 KCIKMKRVKCNKVR-TVTEIVNSDEKIQKTYELAEFDLKNLSSLESYETLKIKLALSKYM 661 K + KR K++ T E+V +K +K + L + +LK L E Y+ LK K L KY+ Sbjct: 68 KSAEAKRESKKKIKETERELV---QKGKKPFYLRKSELKKLELAEKYKELKSKGKLQKYL 124 >SB_458| Best HMM Match : DUF19 (HMM E-Value=1.5) Length = 518 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 56 YLLIRGDYESSSELKSLRDLNPWVQNTLLKLL 151 Y L+RG +SS E+KS+R +PW LL L+ Sbjct: 68 YYLVRGFLKSSEEMKSIRH-SPWSVVALLTLV 98 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,081,065 Number of Sequences: 59808 Number of extensions: 316066 Number of successful extensions: 602 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 601 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -