BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10e11 (702 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY395750-1|AAR89513.1| 1199|Drosophila melanogaster ATM protein ... 29 4.6 AE014297-1966|ABI31168.1| 2767|Drosophila melanogaster CG6535-PB... 29 4.6 >AY395750-1|AAR89513.1| 1199|Drosophila melanogaster ATM protein protein. Length = 1199 Score = 29.5 bits (63), Expect = 4.6 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 2/73 (2%) Frame = +2 Query: 452 YEHASKANVVDKCIKMKRVKCNKVRTVTEIVNSDEKIQKTY--ELAEFDLKNLSSLESYE 625 Y H+ + + I+ R KV T+ N D ++ A D + L+ +E Sbjct: 588 YRHSQEYQTLKDIIEQNRQTAEKV---TQRENQDRRVISVQMKRYASLDEQQLNQIEEKL 644 Query: 626 TLKIKLALSKYMA 664 T ++LAL+ YMA Sbjct: 645 TEYLRLALTNYMA 657 >AE014297-1966|ABI31168.1| 2767|Drosophila melanogaster CG6535-PB protein. Length = 2767 Score = 29.5 bits (63), Expect = 4.6 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 2/73 (2%) Frame = +2 Query: 452 YEHASKANVVDKCIKMKRVKCNKVRTVTEIVNSDEKIQKTY--ELAEFDLKNLSSLESYE 625 Y H+ + + I+ R KV T+ N D ++ A D + L+ +E Sbjct: 2156 YRHSQEYQTLKDIIEQNRQTAEKV---TQRENQDRRVISVQMKRYASLDEQQLNQIEEKL 2212 Query: 626 TLKIKLALSKYMA 664 T ++LAL+ YMA Sbjct: 2213 TEYLRLALTNYMA 2225 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,795,161 Number of Sequences: 53049 Number of extensions: 457608 Number of successful extensions: 950 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 950 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3087795150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -