BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10e10 (493 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45618| Best HMM Match : Ribosomal_L27e (HMM E-Value=0) 192 2e-49 SB_35383| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 28 3.6 SB_56455| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_40683| Best HMM Match : VWD (HMM E-Value=2.4e-05) 28 4.8 SB_29343| Best HMM Match : PPI_Ypi1 (HMM E-Value=0.91) 28 4.8 SB_48281| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_24332| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_16188| Best HMM Match : KOW (HMM E-Value=5.7e-16) 27 6.4 SB_11435| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_35254| Best HMM Match : Vicilin_N (HMM E-Value=0.066) 27 8.4 >SB_45618| Best HMM Match : Ribosomal_L27e (HMM E-Value=0) Length = 168 Score = 192 bits (467), Expect = 2e-49 Identities = 90/134 (67%), Positives = 106/134 (79%), Gaps = 2/134 (1%) Frame = +1 Query: 40 MGKIMKPGKVVLVLSGRYAGRKAIVVKNYDEGTSDKPYGHAFVAGIDRYPRKVHKRMGKN 219 MGK +K GKVVLVL GRYAG+KA+++KNYD+G+SDKPYGHA VAG+ RYP KV KRMGK Sbjct: 1 MGKFIKSGKVVLVLRGRYAGKKALIIKNYDDGSSDKPYGHALVAGVARYPLKVTKRMGKK 60 Query: 220 KIHKRSKIKPFVKVVNYNHLMPTRYTVDFSFEK-FSAKDL-KDPAKRKKLRFNTRVRFEE 393 + KRSK+KPFVKV NYNHLMPTRY+VD +K KD+ +DPA +KK + EE Sbjct: 61 RTAKRSKVKPFVKVFNYNHLMPTRYSVDVPLDKQVVNKDVFRDPALKKKALREVKSTLEE 120 Query: 394 RYKSGKNKWFFQKL 435 RYKSGKNKWFFQKL Sbjct: 121 RYKSGKNKWFFQKL 134 >SB_35383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 28.3 bits (60), Expect = 3.6 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +1 Query: 325 AKDL--KDPAKRKKLRFNTRVRFEERYKSGKNKWFFQKLRF 441 +KDL + P +K FN + E R++ G K F+++LRF Sbjct: 2 SKDLLGERPMYARKDAFNAYLTMERRFEKGDIKTFWRELRF 42 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/61 (31%), Positives = 27/61 (44%) Frame = +3 Query: 117 QELRRRYLRQAIRACLRRWYRQVPPESAQEDGKE*NPQEVQDKAFRQGCKL*SLDANTLY 296 +E R+ L A R R Y + PE GK P+ + +R GCK + N LY Sbjct: 171 RETSRKELEYASR--FRPAYARYAPELGCRTGKNQEPKRITRVQWRFGCKFPNPVTNELY 228 Query: 297 S 299 + Sbjct: 229 A 229 >SB_56455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 27.9 bits (59), Expect = 4.8 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = +1 Query: 127 DEGTSDKPYGHAFVAGIDRYPRKVHKRMGKNKIHKRSKIKPFVKVVNYN 273 D+ D Y + AG+ + + HK+ G K + KP +K VN N Sbjct: 198 DDDIDDDEYHPGYSAGLKKRLKAAHKQRGYTKAFAKRGTKP-MKEVNSN 245 >SB_40683| Best HMM Match : VWD (HMM E-Value=2.4e-05) Length = 2200 Score = 27.9 bits (59), Expect = 4.8 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 1/77 (1%) Frame = +1 Query: 175 IDRYPRKVHKRMGKNKIHKRSKIKPFVKVVNYNHLMP-TRYTVDFSFEKFSAKDLKDPAK 351 I Y KVH K + + ++K+ PF K N ++P + V +FEK++A + +K Sbjct: 1083 IKMYMEKVHYYKAKVETYYKTKVMPFYK----NKVVPFYKNKVIPAFEKYTAL-ADELSK 1137 Query: 352 RKKLRFNTRVRFEERYK 402 LR T + YK Sbjct: 1138 NMTLRAKTYILNSRPYK 1154 >SB_29343| Best HMM Match : PPI_Ypi1 (HMM E-Value=0.91) Length = 383 Score = 27.9 bits (59), Expect = 4.8 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = +1 Query: 313 EKFSAKDLKDPAKRKKLRFNTRVRFE---ERYKSGKNKWFFQKLR 438 ++ S D +D +KRK++RF FE + YK+ FQK R Sbjct: 237 DETSGNDTEDESKRKRVRFAEGTNFENERQTYKTRVKNITFQKDR 281 >SB_48281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 27.5 bits (58), Expect = 6.4 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 6/53 (11%) Frame = +3 Query: 126 RRRYLRQAI---RACLRRWYRQVPPESAQEDG---KE*NPQEVQDKAFRQGCK 266 +RR L I +AC+ +WY++V P +A + G K N + ++ K F+ K Sbjct: 6 KRRTLENIIENFKACVLKWYQEVDPTNAIKRGQIAKTFNDEIIRFKRFQAAYK 58 >SB_24332| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 27.5 bits (58), Expect = 6.4 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = -3 Query: 182 LSIPATKACPYGLSEVPSS*FLTTIALRP--AYRPLRTSTTLPGFIILPILEGY 27 +S+ A+ + PY +P+S FL ++ P Y+PL P + L Y Sbjct: 13 VSLQASASYPYKPPRIPTSLFLVSLQAPPLYTYKPLPRIPASPSLVFLQAPPSY 66 >SB_16188| Best HMM Match : KOW (HMM E-Value=5.7e-16) Length = 105 Score = 27.5 bits (58), Expect = 6.4 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +1 Query: 25 EYPS-KMGKIMKPGKVVLVLSGRYAGRKAIVVKNYD 129 ++P+ ++GK K G V V+ GRY G ++V+ D Sbjct: 58 DFPAHELGKHFKMGDHVKVIGGRYEGDTGLIVRVED 93 >SB_11435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 27.5 bits (58), Expect = 6.4 Identities = 18/61 (29%), Positives = 33/61 (54%) Frame = +1 Query: 154 GHAFVAGIDRYPRKVHKRMGKNKIHKRSKIKPFVKVVNYNHLMPTRYTVDFSFEKFSAKD 333 GH F++ ID++ RK HK +KI R+ IK ++Y+ + T+ +D ++ A Sbjct: 99 GHRFLSLIDKHFRKDHK---LSKIFNRNTIK-----ISYSCMSNTKQIIDSHSKRIIASS 150 Query: 334 L 336 + Sbjct: 151 I 151 >SB_35254| Best HMM Match : Vicilin_N (HMM E-Value=0.066) Length = 909 Score = 27.1 bits (57), Expect = 8.4 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 322 SAKDLKDPAKRKKLRFNTRVRFEERYKSGKNKWFFQKLR 438 SAK+L++ +RK+ +NT E RY+ K K Q R Sbjct: 562 SAKELEEELERKREDYNTAAD-ERRYQMAKKKDTLQATR 599 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,989,521 Number of Sequences: 59808 Number of extensions: 303565 Number of successful extensions: 843 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 842 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1050596726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -