BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10e05 (694 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 25 2.3 AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 25 3.0 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 24 5.2 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 24 5.2 AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 24 5.2 AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 24 5.2 AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase... 24 5.2 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 6.9 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 23 6.9 CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 23 9.1 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 9.1 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 25.0 bits (52), Expect = 2.3 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 257 FRRRRQSIQNDDR*AFSWK*RKRYQANFNSKRNQLPR 367 F+ SIQ ++ WK R Q +F K++QL R Sbjct: 869 FKNNVFSIQEVEQLVTLWKNRNDVQKSFREKQDQLAR 905 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 24.6 bits (51), Expect = 3.0 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 581 RRIAFFRRDQRPNASRWCWRSI 646 +R+AFFR D N W W + Sbjct: 208 QRMAFFREDIGVNLHHWHWHLV 229 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 577 DTREQNVFGFVVSRMLLVVA*TLCITRCVPL 485 D +EQ V GFVVS ++ + I R +P+ Sbjct: 840 DVKEQRVSGFVVSVLVGLSVVMAPILRLIPM 870 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 581 RRIAFFRRDQRPNASRWCWRSI 646 +R+A+FR D N W W + Sbjct: 194 QRLAYFREDIGVNLHHWHWHLV 215 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 581 RRIAFFRRDQRPNASRWCWRSI 646 +R+A+FR D N W W + Sbjct: 207 QRLAYFREDIGVNLHHWHWHLV 228 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 581 RRIAFFRRDQRPNASRWCWRSI 646 +R+A+FR D N W W + Sbjct: 194 QRLAYFREDIGVNLHHWHWHLV 215 >AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase subunit 2 protein. Length = 686 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 581 RRIAFFRRDQRPNASRWCWRSI 646 +R+A+FR D N W W + Sbjct: 193 QRLAYFREDIGVNLHHWHWHLV 214 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.4 bits (48), Expect = 6.9 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -1 Query: 130 TMDAKMQRLTLICRGAIPTGISAILL 53 T+DA RLT + IP I + L Sbjct: 633 TLDASFNRLTRVTPATIPNSIEFLFL 658 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 23.4 bits (48), Expect = 6.9 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 581 RRIAFFRRDQRPNASRWCWRSI 646 +R+A+FR D N W W + Sbjct: 193 QRMAYFREDIGVNMHHWHWHLV 214 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 23.0 bits (47), Expect = 9.1 Identities = 12/42 (28%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +2 Query: 551 PEHVLFACVARRIA---FFRRDQRPNASRWCWRSII*QLQWI 667 PE V+ + R+ FF D A W + + LQW+ Sbjct: 142 PEDVVVVTINYRLGILGFFSTDDVHAAGNWGMKDCVMALQWV 183 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 23.0 bits (47), Expect = 9.1 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 118 KMQRLTLICRGAIPTGISAILLPL 47 K QRL LI + P+G+S PL Sbjct: 470 KRQRLVLIPKPGKPSGVSCSYRPL 493 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 743,138 Number of Sequences: 2352 Number of extensions: 14597 Number of successful extensions: 293 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 293 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -