BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10e05 (694 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39370.2 68417.m05572 ubiquitin-specific protease 27, putativ... 30 1.7 At4g39370.1 68417.m05573 ubiquitin-specific protease 27, putativ... 30 1.7 At5g12230.1 68418.m01435 expressed protein 29 2.2 At2g32910.1 68415.m04035 expressed protein 29 2.9 At2g36400.1 68415.m04467 expressed protein nearly identical to t... 29 3.9 At1g58025.1 68414.m06576 DNA-binding bromodomain-containing prot... 28 5.1 At1g06750.1 68414.m00717 hypothetical protein 28 5.1 At4g09450.1 68417.m01555 myb family transcription factor contain... 28 6.8 At1g02790.1 68414.m00235 exopolygalacturonase / galacturan 1,4-a... 28 6.8 At4g14180.1 68417.m02189 expressed protein ; expression supporte... 27 8.9 At3g29265.1 68416.m03673 hypothetical protein 27 8.9 >At4g39370.2 68417.m05572 ubiquitin-specific protease 27, putative (UBP27) similar to GI:11993494; ubiquitin specific protease 66 - Gallus gallus,PID:g3800764 Length = 361 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +3 Query: 333 RILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVIC 455 R ++ + T+Y + FNL S A + + HLI + +E + V+C Sbjct: 147 RKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQEEI-VVC 186 >At4g39370.1 68417.m05573 ubiquitin-specific protease 27, putative (UBP27) similar to GI:11993494; ubiquitin specific protease 66 - Gallus gallus,PID:g3800764 Length = 494 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +3 Query: 333 RILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVIC 455 R ++ + T+Y + FNL S A + + HLI + +E + V+C Sbjct: 147 RKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQEEI-VVC 186 >At5g12230.1 68418.m01435 expressed protein Length = 221 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 458 QSKIYRRFHKRHATRYTQRLRNYKKHSRHHK 550 +SK R HK+H R + R +KKH HK Sbjct: 121 ESKDRDRKHKKHKDRDKDKDREHKKHKHKHK 151 >At2g32910.1 68415.m04035 expressed protein Length = 691 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 174 DAYHDDGWFICNSHLIKRFKMSKMVLPIFDEDD 272 D+Y D ++IC H ++R + MV P +DD Sbjct: 610 DSYRRDPYYICERHALERPPRTYMVSPGRQDDD 642 >At2g36400.1 68415.m04467 expressed protein nearly identical to transcription activator GRL3 [Arabidopsis thaliana] GI:21539884 (unpublished); supporting cDNA gi|21539883|gb|AY102636.1| Length = 398 Score = 28.7 bits (61), Expect = 3.9 Identities = 19/64 (29%), Positives = 26/64 (40%) Frame = +3 Query: 3 RDFFLNHKIAVVHIYNGNNMALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAY 182 RD F HK H++ G N + PV P + AS V+ A T + S A+ Sbjct: 162 RDVFAGHKYCERHMHRGRNRSRKPV-ETPTTVNATATSMASSVAAAATTTTATTTSTFAF 220 Query: 183 HDDG 194 G Sbjct: 221 GGGG 224 >At1g58025.1 68414.m06576 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487; contains prenyl group binding site (CAAX box) Prosite:PS00294 Length = 769 Score = 28.3 bits (60), Expect = 5.1 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +2 Query: 518 RNYKKHSRHHKPEHVLFACVARR 586 +++K+H RHHK + + CV +R Sbjct: 340 KSHKRHGRHHKSDCMCAICVLKR 362 >At1g06750.1 68414.m00717 hypothetical protein Length = 495 Score = 28.3 bits (60), Expect = 5.1 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = +2 Query: 452 MRQSKIYRRFHKRHATRYTQRLRNYKKHSRHHKPEHVLFACVARRIAFFRRDQRPN 619 M + ++ R + T+ RL++ KH H K E VAR++ F R + PN Sbjct: 1 MIAAAVHYRLRRLRDTKIIPRLKSSHKHKGHEKLER-FSHYVARQMGFKDRRECPN 55 >At4g09450.1 68417.m01555 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 200 Score = 27.9 bits (59), Expect = 6.8 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +3 Query: 213 HLIKRFKMSKMVLPIFDEDDNQFKMTIARHLVGN-KERGI 329 H I+R + K VLP + EDD K+T A GN K+ GI Sbjct: 53 HDIERIESGKYVLPKYPEDD-YVKLTEAGESKGNGKKTGI 91 >At1g02790.1 68414.m00235 exopolygalacturonase / galacturan 1,4-alpha-galacturonidase (PGA3) / pectinase identical to SP|P49062 Exopolygalacturonase clone GBGE184 precursor (EC 3.2.1.67) (ExoPG) (Galacturan 1,4-alpha-galacturonidase) {Arabidopsis thaliana} Length = 422 Score = 27.9 bits (59), Expect = 6.8 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Frame = +3 Query: 339 LIPSATNYQEVFN--LNSMMQAEQLIFHLIYNNEEAVNVICDNLKYTEGFTSGTQRVIHS 512 L P++ ++ + N +N + FH+ E VN+ N+K T S IH Sbjct: 167 LPPTSLKFRNMKNVEINGISSVNAKAFHMFLVKTENVNI--QNIKLTAPAESPNTDGIHL 224 Query: 513 VYATTRSILDTT 548 A SILD+T Sbjct: 225 SNADNVSILDST 236 >At4g14180.1 68417.m02189 expressed protein ; expression supported by MPSS Length = 1268 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/61 (24%), Positives = 36/61 (59%), Gaps = 3/61 (4%) Frame = +3 Query: 366 EVFNLNSMMQAEQLIFHLIYNNE---EAVNVICDNLKYTEGFTSGTQRVIHSVYATTRSI 536 E + ++ ++AE++IFHL+ E ++N+ ++LK+ S ++ +I+ + +R+ Sbjct: 666 ERYQISYSLEAERIIFHLLNEYEWDLGSINIHLESLKWLFQQESISKSLIYQIQKISRNN 725 Query: 537 L 539 L Sbjct: 726 L 726 >At3g29265.1 68416.m03673 hypothetical protein Length = 236 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = +2 Query: 464 KIYRRFHKRHATRYTQ-RLRNYKKHS 538 K Y FHK H T Q RLR Y K S Sbjct: 81 KTYTTFHKNHITLQQQYRLRGYTKFS 106 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,959,129 Number of Sequences: 28952 Number of extensions: 300718 Number of successful extensions: 751 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 750 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1477286152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -