BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10e04 (718 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0209 - 23282848-23284110 33 0.23 10_02_0202 - 6770448-6770561,6771185-6771279,6771638-6771686,677... 29 2.8 04_03_0927 + 20871487-20871903,20872667-20872812,20873204-208733... 29 2.8 08_02_1332 + 26207164-26207257,26207454-26207530,26207771-262078... 29 3.7 02_04_0377 - 22479800-22479872,22479920-22479981,22480007-224803... 29 4.9 >05_05_0209 - 23282848-23284110 Length = 420 Score = 33.1 bits (72), Expect = 0.23 Identities = 24/60 (40%), Positives = 31/60 (51%), Gaps = 6/60 (10%) Frame = +3 Query: 111 FPYAALSYINVTLCTYTAMLVGY--MATFNEFEYLQYWFLLSFL---MSVALNAPTL-WT 272 FP A + V AML MAT E+LQ+WF+LS L ++VALN + WT Sbjct: 235 FPSARARAVAVAGHLNRAMLAALVSMATILAVEFLQWWFMLSLLPEAIAVALNVAIMAWT 294 >10_02_0202 - 6770448-6770561,6771185-6771279,6771638-6771686, 6771795-6771843,6772035-6772228 Length = 166 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +3 Query: 147 LCTYTAMLVGYMATFNEFEYLQYWFLLSFLMSVALNAPTLWTA 275 L + A+++G + YW LL L +V LN +WTA Sbjct: 50 LNAFGAIVLGAPIGIKYWAATTYWSLLMSLFTVVLNVSAIWTA 92 >04_03_0927 + 20871487-20871903,20872667-20872812,20873204-20873301, 20873378-20873572,20873670-20873797,20873892-20874050, 20875119-20875223,20875449-20875559,20875653-20875790, 20875909-20876091,20876362-20876517,20876615-20876738, 20876820-20877030,20877614-20877729,20877828-20878053, 20878218-20878311,20879198-20879275,20879822-20879971, 20880086-20880292,20880584-20880788,20880990-20881096 Length = 1117 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 368 KHHIIQQHVTKVHGLEQLHFVNYFMGFCGFERR 270 K + I QH+ ++H +L F+N F+ F G+ R Sbjct: 735 KSYDISQHLHEIHESVRLAFLNSFLDFAGYLER 767 >08_02_1332 + 26207164-26207257,26207454-26207530,26207771-26207841, 26208448-26208502,26209066-26209187,26209272-26209353, 26210070-26210160,26210759-26210982,26211294-26211413, 26211523-26211705 Length = 372 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -3 Query: 227 QQKPVL*IFKFVECCHVSH 171 +QKPVL + F+ CCH SH Sbjct: 97 RQKPVL--YTFINCCHTSH 113 >02_04_0377 - 22479800-22479872,22479920-22479981,22480007-22480300, 22481723-22481825,22481949-22482046 Length = 209 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/61 (26%), Positives = 27/61 (44%) Frame = +3 Query: 72 TKYTRLSTDTKVKFPYAALSYINVTLCTYTAMLVGYMATFNEFEYLQYWFLLSFLMSVAL 251 T++T++ D K P + LC + + + + LQ W L FL+S+ L Sbjct: 135 TEFTQMLVDGTTKLPQSLQVRSEPILCLLEMLFFLHPVGSTKEKALQMWTLSLFLLSLVL 194 Query: 252 N 254 N Sbjct: 195 N 195 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,012,328 Number of Sequences: 37544 Number of extensions: 321155 Number of successful extensions: 602 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 602 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -