Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc10d23
         (719 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g58230.1 68414.m06618 WD-40 repeat family protein / beige-rel...    29   2.3  

>At1g58230.1 68414.m06618 WD-40 repeat family protein / beige-related
            contains Pfam PF00400: WD domain, G-beta repeat; similar
            to Lipopolysaccharide-responsive and beige-like anchor
            protein (CDC4-like protein) (Beige-like protein)
            (SP:P50851) [Homo sapiens}
          Length = 1280

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 12/37 (32%), Positives = 24/37 (64%)
 Frame = -2

Query: 541  VAAGGKNKCAWRSVQECDSVLRLDGTGKVVINLTISR 431
            V+AG + +   RS+   + V R +G GK++ +LT+++
Sbjct: 1210 VSAGDQGQIIVRSMNTLEVVKRYNGAGKIITSLTVTQ 1246


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,323,058
Number of Sequences: 28952
Number of extensions: 310931
Number of successful extensions: 751
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 733
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 751
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1565336320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)