BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10d20 (734 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3C7.10 |pex13||peroxin-13|Schizosaccharomyces pombe|chr 1|||... 27 3.7 SPAC1F7.05 |cdc22||ribonucleoside reductase large subunit Cdc22|... 26 4.8 SPBC1703.14c |top1||DNA topoisomerase I|Schizosaccharomyces pomb... 25 8.5 >SPAC3C7.10 |pex13||peroxin-13|Schizosaccharomyces pombe|chr 1|||Manual Length = 288 Score = 26.6 bits (56), Expect = 3.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 157 VSPHIGSRSFVPYIRFNSCLPDSNP 83 V+P+ + F PY FNS +P NP Sbjct: 44 VNPNYYNMGFNPYSGFNSFIPSFNP 68 >SPAC1F7.05 |cdc22||ribonucleoside reductase large subunit Cdc22|Schizosaccharomyces pombe|chr 1|||Manual Length = 811 Score = 26.2 bits (55), Expect = 4.8 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = +1 Query: 190 NFVCQYFFE--SILLPNPGNPRPRASAKTIKTIPRCAFASFLCVAFVCAVLVKTCLGL 357 N + Q +F S L N G PRP+ S+ + T+ + +CA++ KT G+ Sbjct: 191 NLMSQRYFTHASPTLFNAGTPRPQLSSCFLVTMKDDSIEGIYDTLKMCAMISKTAGGI 248 >SPBC1703.14c |top1||DNA topoisomerase I|Schizosaccharomyces pombe|chr 2|||Manual Length = 814 Score = 25.4 bits (53), Expect = 8.5 Identities = 13/44 (29%), Positives = 27/44 (61%), Gaps = 3/44 (6%) Frame = -3 Query: 162 RRCHPT--SVRGRLFRTFVSIHVYP-IPIPAELPGLDFALIKNE 40 R HP S++ R++ ++I++ +P+P LPG +A +K++ Sbjct: 343 RGSHPKTGSLKRRVYPEQITINIGEGVPVPEPLPGHQWAEVKHD 386 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,877,954 Number of Sequences: 5004 Number of extensions: 56536 Number of successful extensions: 115 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 347244562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -