BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10d17 (677 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_02_0036 + 10468636-10468938,10469014-10469109,10469247-104694... 29 3.4 03_03_0063 - 14176137-14176769,14178220-14178513,14178966-14179058 29 4.5 02_01_0557 + 4103721-4104616,4105428-4105626 29 4.5 01_06_1014 - 33810112-33811995 29 4.5 07_03_1003 + 23239829-23240121,23240257-23240349,23240785-232409... 28 6.0 05_05_0256 - 23647736-23648947 28 6.0 04_03_0923 + 20843477-20845044,20846081-20846996 28 7.9 >01_02_0036 + 10468636-10468938,10469014-10469109,10469247-10469453, 10470762-10471097,10471469-10471582,10471634-10471639 Length = 353 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/53 (37%), Positives = 28/53 (52%) Frame = -3 Query: 315 YIKYL*VTPSSFHCNVNGNL*MNALSKNRPVSSTNSRTAVS*TFASQQSR*PR 157 Y +YL VT H + + +L MN + NRP + RTA + T +QQ PR Sbjct: 170 YHQYLQVTQQQNHRHPDHHLIMNN-NNNRPSLAQTHRTAATTTATTQQFLEPR 221 >03_03_0063 - 14176137-14176769,14178220-14178513,14178966-14179058 Length = 339 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +3 Query: 153 YHEVIAIVATQKFTKLPCASLWKKLAGFLTARSSTSFHLRYNGKTTVSL 299 YH + Q FT+ PC +++A LTARS R G+ VS+ Sbjct: 3 YHYRTVVSQQQNFTR-PCFGWSRRIAQQLTARSMAFLVERCGGEMVVSM 50 >02_01_0557 + 4103721-4104616,4105428-4105626 Length = 364 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = -2 Query: 661 KCVQFLGGIVVVYLF*SGVEKVLQLPIIETLLDAAHKTKKFNVIAVIV 518 K ++FLG +V+ YL + + L + + L+ +AHK K I +IV Sbjct: 93 KTIKFLGFVVMGYLLITNLGGSLLIYLYLNLVPSAHKILKRKGIGIIV 140 >01_06_1014 - 33810112-33811995 Length = 627 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +2 Query: 434 FNCEITRSLAIVPLNKYFNYMNDKQLITYDYSNYIEFFSFVRSI 565 +NC + + + LNK Y+ K +T D N +E +RS+ Sbjct: 446 YNCRVAELVRLEKLNKLSVYIGSKVAVTGDELNELENIKGLRSL 489 >07_03_1003 + 23239829-23240121,23240257-23240349,23240785-23240993, 23241585-23241729,23241809-23241881,23242165-23242311, 23242411-23242536,23242653-23242712 Length = 381 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -1 Query: 395 TCPATTSRCTCWVWRSRQSSCRARRLR 315 +CPA+++R T W R+R SS A R R Sbjct: 32 SCPASSARRTTWRPRARLSSGNAARAR 58 >05_05_0256 - 23647736-23648947 Length = 403 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -1 Query: 389 PATTSRCTCWVWRSRQSSCRARRLRISNTCK*HRRL 282 PA T+ CW R R +SCR++ R + HRRL Sbjct: 362 PAETAASGCWGRRRRTTSCRSKPRRAT-----HRRL 392 >04_03_0923 + 20843477-20845044,20846081-20846996 Length = 827 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 317 VGVVRGNLIDVNAKPNTYTVKLLPGTFGNDYRIMLK 424 VG++ ID+ ++ KL G+FG+ +R ML+ Sbjct: 488 VGIIAFRYIDLQRATKNFSKKLGGGSFGSVFRAMLR 523 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,198,092 Number of Sequences: 37544 Number of extensions: 328497 Number of successful extensions: 859 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 846 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 859 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -