BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10d17 (677 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-686|AAF47786.2| 354|Drosophila melanogaster CG10862-PA... 35 0.12 AE014298-2800|AAF48917.3| 380|Drosophila melanogaster CG7440-PA... 29 4.4 AE014297-652|AAF54150.2| 124|Drosophila melanogaster CG10928-PA... 29 7.7 >AE014296-686|AAF47786.2| 354|Drosophila melanogaster CG10862-PA protein. Length = 354 Score = 34.7 bits (76), Expect = 0.12 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 3/64 (4%) Frame = -3 Query: 393 VPGNNFTVYVLGLAFTSIKLPRTTPTYIKYL*VTPSSFHCNV--NGNL*MNAL-SKNRPV 223 +PG + TVY G I PR P Y YL ++HCN+ +G + ++ L SK P Sbjct: 244 IPGPSETVYEGGRFRVEIVFPRNYPFYPPYLAFLTKTYHCNIALSGRICLDILGSKWSPA 303 Query: 222 SSTN 211 S + Sbjct: 304 LSVS 307 >AE014298-2800|AAF48917.3| 380|Drosophila melanogaster CG7440-PA, isoform A protein. Length = 380 Score = 29.5 bits (63), Expect = 4.4 Identities = 26/83 (31%), Positives = 38/83 (45%), Gaps = 5/83 (6%) Frame = +2 Query: 302 KYLIYVGVVRGNLIDVNAKPNTYTVK----LLPGTFGNDYRIMLKPRRFNCEITRS-LAI 466 K L +GV G+ D + Y + LL G G D+ + K +N L+ Sbjct: 268 KCLFNLGVKAGDSRDEQLRNRFYPIAPYGALLSGNVGMDFWLY-KYAYYNPRSCMDCLSE 326 Query: 467 VPLNKYFNYMNDKQLITYDYSNY 535 P+ F+Y++ KQL YDY NY Sbjct: 327 YPVA--FHYVHSKQLYVYDYFNY 347 >AE014297-652|AAF54150.2| 124|Drosophila melanogaster CG10928-PA protein. Length = 124 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -1 Query: 407 SRCQTCPATTSRCTCWVWRSRQSSCR 330 +R Q T+S +CW++ R SSCR Sbjct: 90 TRSQLTANTSSSRSCWIYSIRMSSCR 115 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,826,221 Number of Sequences: 53049 Number of extensions: 572738 Number of successful extensions: 1439 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1439 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2951284050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -