BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10d17 (677 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 24 1.5 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.7 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.7 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 23 2.7 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 6.2 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 8.2 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 8.2 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +2 Query: 311 IYVGVVRGNLIDVNAKPNTYTVKLLPGTFGNDYRIMLKP 427 + +G+ LIDVN K T + NDY++ P Sbjct: 48 VKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNP 86 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.0 bits (47), Expect = 2.7 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +2 Query: 338 LIDVNAKPNTYTVKLLPGTFGNDYRIMLKPRRF 436 LIDVN K T L DY++ +P+ + Sbjct: 65 LIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEY 97 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.0 bits (47), Expect = 2.7 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +2 Query: 338 LIDVNAKPNTYTVKLLPGTFGNDYRIMLKPRRF 436 LIDVN K T L DY++ +P+ + Sbjct: 65 LIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEY 97 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 23.0 bits (47), Expect = 2.7 Identities = 13/48 (27%), Positives = 20/48 (41%) Frame = +2 Query: 293 VTYKYLIYVGVVRGNLIDVNAKPNTYTVKLLPGTFGNDYRIMLKPRRF 436 VT + + + LIDVN K T L DY++ P+ + Sbjct: 46 VTDALTVKIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLKWDPKEY 93 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 6.2 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 Query: 291 PSSFHCNVNGN 259 P++F CNV GN Sbjct: 324 PATFTCNVRGN 334 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.4 bits (43), Expect = 8.2 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +2 Query: 356 KPNTYTVKLLPGTFGNDYRIMLKPRRFNCEITRSLAIVPLNKYFNYMNDKQLITY 520 K Y + + ++ML N ++R++ +V N NY N+ QL T+ Sbjct: 3 KNRNYALDVSSAASKTSSKVMLTRGTVNDIVSRNITMVLENLLMNYENN-QLPTH 56 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +2 Query: 230 RFFDSAFIYKFPFTLQWKDDGVTYKYLI 313 ++F+ + + F L + + GVTYK+ I Sbjct: 47 KYFEQT-LNELNFNLNYVNKGVTYKHTI 73 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,470 Number of Sequences: 438 Number of extensions: 3819 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -