BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10d16 (425 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY118959-1|AAM50819.1| 84|Drosophila melanogaster LD37859p pro... 166 9e-42 AE014297-3747|AAF56428.1| 84|Drosophila melanogaster CG10423-P... 166 9e-42 AY113459-1|AAM29464.1| 361|Drosophila melanogaster RE36989p pro... 29 2.0 AE014134-864|AAF52211.2| 388|Drosophila melanogaster CG14040-PA... 29 2.0 >AY118959-1|AAM50819.1| 84|Drosophila melanogaster LD37859p protein. Length = 84 Score = 166 bits (404), Expect = 9e-42 Identities = 73/82 (89%), Positives = 77/82 (93%) Frame = +2 Query: 32 MPLAIDLLHPSPASERRKHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCS 211 MPLA DLLHP PA E+RKHKLKRLV HPNSYFMDVKCPGCY+ITTVFSHAQ VVVCAGC+ Sbjct: 1 MPLAKDLLHPLPAEEKRKHKLKRLVQHPNSYFMDVKCPGCYRITTVFSHAQGVVVCAGCA 60 Query: 212 TILCQPTGGRARLTEGCSFRRK 277 TILCQPTGGRA+LTEGCSFRRK Sbjct: 61 TILCQPTGGRAKLTEGCSFRRK 82 >AE014297-3747|AAF56428.1| 84|Drosophila melanogaster CG10423-PA protein. Length = 84 Score = 166 bits (404), Expect = 9e-42 Identities = 73/82 (89%), Positives = 77/82 (93%) Frame = +2 Query: 32 MPLAIDLLHPSPASERRKHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCS 211 MPLA DLLHP PA E+RKHKLKRLV HPNSYFMDVKCPGCY+ITTVFSHAQ VVVCAGC+ Sbjct: 1 MPLAKDLLHPLPAEEKRKHKLKRLVQHPNSYFMDVKCPGCYRITTVFSHAQGVVVCAGCA 60 Query: 212 TILCQPTGGRARLTEGCSFRRK 277 TILCQPTGGRA+LTEGCSFRRK Sbjct: 61 TILCQPTGGRAKLTEGCSFRRK 82 >AY113459-1|AAM29464.1| 361|Drosophila melanogaster RE36989p protein. Length = 361 Score = 29.5 bits (63), Expect = 2.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 310 YLILRFFFQLYNGVIFFKFTTMDPSEHY 393 Y++ F + LYN + F T DP+ +Y Sbjct: 88 YMVPAFLYCLYNNLAFVNLATFDPTTYY 115 >AE014134-864|AAF52211.2| 388|Drosophila melanogaster CG14040-PA protein. Length = 388 Score = 29.5 bits (63), Expect = 2.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 310 YLILRFFFQLYNGVIFFKFTTMDPSEHY 393 Y++ F + LYN + F T DP+ +Y Sbjct: 88 YMVPAFLYCLYNNLAFVNLATFDPTTYY 115 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,856,385 Number of Sequences: 53049 Number of extensions: 352845 Number of successful extensions: 813 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 783 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 813 length of database: 24,988,368 effective HSP length: 78 effective length of database: 20,850,546 effective search space used: 1313584398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -