BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10d15 (916 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 5.1 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 5.1 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 5.1 AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 22 6.8 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 22 6.8 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 5.1 Identities = 21/85 (24%), Positives = 38/85 (44%), Gaps = 8/85 (9%) Frame = +2 Query: 197 EITSTASTNAHSSKRVLISAKKNTLNKAIRCICRRKQYYSTK*ALYSCSCAPR*PTRRSC 376 E + STN + V + +K +++NK + + +K +S ++ AP +R Sbjct: 460 ESYGSGSTNFNERPAVAVVSKSSSINK-LEDLRNKKSCHSGYKDSFAGWTAPIYTLKRKG 518 Query: 377 KIG--------FTNTCCPSAPPDSR 427 I F+ +C P AP DS+ Sbjct: 519 LIKSENEAADFFSGSCAPGAPLDSK 543 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 5.1 Identities = 21/85 (24%), Positives = 38/85 (44%), Gaps = 8/85 (9%) Frame = +2 Query: 197 EITSTASTNAHSSKRVLISAKKNTLNKAIRCICRRKQYYSTK*ALYSCSCAPR*PTRRSC 376 E + STN + V + +K +++NK + + +K +S ++ AP +R Sbjct: 460 ESYGSGSTNFNERPAVAVVSKSSSINK-LEDLRNKKSCHSGYKDSFAGWTAPIYTLKRKG 518 Query: 377 KIG--------FTNTCCPSAPPDSR 427 I F+ +C P AP DS+ Sbjct: 519 LIKSENEAADFFSGSCAPGAPLDSK 543 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 5.1 Identities = 21/85 (24%), Positives = 38/85 (44%), Gaps = 8/85 (9%) Frame = +2 Query: 197 EITSTASTNAHSSKRVLISAKKNTLNKAIRCICRRKQYYSTK*ALYSCSCAPR*PTRRSC 376 E + STN + V + +K +++NK + + +K +S ++ AP +R Sbjct: 460 ESYGSGSTNFNERPAVAVVSKSSSINK-LEDLRNKKSCHSGYKDSFAGWTAPIYTLKRKG 518 Query: 377 KIG--------FTNTCCPSAPPDSR 427 I F+ +C P AP DS+ Sbjct: 519 LIKSENEAADFFSGSCAPGAPLDSK 543 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 22.2 bits (45), Expect = 6.8 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 351 QDDQRGGAAKLVLRTRVAPVHR 416 +D GG A + +T VAP+ R Sbjct: 12 KDFLAGGVAAAISKTTVAPIER 33 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 22.2 bits (45), Expect = 6.8 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 351 QDDQRGGAAKLVLRTRVAPVHR 416 +D GG A + +T VAP+ R Sbjct: 12 KDFLAGGVAAAISKTTVAPIER 33 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,167 Number of Sequences: 438 Number of extensions: 4440 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29750994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -