BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10d12 (683 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. 23 3.6 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 23 3.6 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 21 8.3 EF013227-1|ABK54581.1| 119|Apis mellifera elongation factor 1-a... 21 8.3 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 21 8.3 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 8.3 >AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. Length = 126 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/36 (22%), Positives = 20/36 (55%) Frame = +1 Query: 205 RLLKTTMGKISLFFLALIASSVMALYRVPLHRMKTA 312 R+++ +GK+ + + + V++LY P+ + A Sbjct: 76 RVIRAKLGKVGVHCMKTTQAVVVSLYEDPIQPQQAA 111 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 22.6 bits (46), Expect = 3.6 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -1 Query: 173 IKYLLRQVFNKKKHSGFRQERISISTYCL*EIDYCYLLIY 54 I LL VF K SG+ R ++YCL D C+ Y Sbjct: 9 IAVLLAIVFLFDKCSGYPSIRQGTTSYCLGCGDSCHKCKY 48 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 484 SNLWVPSKKCHYTNIAC 534 SN + P CH +IAC Sbjct: 354 SNGYTPVLDCHTAHIAC 370 >EF013227-1|ABK54581.1| 119|Apis mellifera elongation factor 1-alpha protein. Length = 119 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 484 SNLWVPSKKCHYTNIAC 534 SN + P CH +IAC Sbjct: 65 SNGYTPVLDCHTAHIAC 81 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 484 SNLWVPSKKCHYTNIAC 534 SN + P CH +IAC Sbjct: 354 SNGYTPVLDCHTAHIAC 370 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 8.3 Identities = 16/57 (28%), Positives = 26/57 (45%) Frame = +1 Query: 226 GKISLFFLALIASSVMALYRVPLHRMKTARTHFHEVGTELELLRLKYDVTGPSPEPL 396 GK+++ + S + ++ V L + VG +E+ K DVTG P PL Sbjct: 289 GKLNVNEFYMAFSKLYSVSVVSLDKSLEVNHISARVGDNVEI---KCDVTGTPPPPL 342 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,524 Number of Sequences: 438 Number of extensions: 4233 Number of successful extensions: 15 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -