BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10d05 (204 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 27 0.017 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 27 0.017 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 25 0.068 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 23 0.36 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 0.63 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 0.63 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 0.63 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 0.63 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 0.63 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 0.63 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 0.63 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 22 0.84 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 1.1 M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-... 21 1.9 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 21 1.9 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 21 1.9 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 21 1.9 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 20 2.6 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 20 2.6 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 19 4.5 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 19 4.5 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 19 4.5 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 19 4.5 AB083209-1|BAC54133.1| 87|Apis mellifera hypothetical protein ... 19 4.5 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 19 5.9 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 19 5.9 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 19 5.9 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 19 7.8 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 19 7.8 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 27.5 bits (58), Expect = 0.017 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -3 Query: 193 MSNLFFINDTNGNNNHLANK*VFYCFRNSFVIKKPINMPNY 71 +SN + N +N NNN+ NK ++Y I P+ +P Y Sbjct: 85 LSNNYISNISNYNNNNNYNKKLYYNINYIEQIPVPVPVPIY 125 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 27.5 bits (58), Expect = 0.017 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -3 Query: 193 MSNLFFINDTNGNNNHLANK*VFYCFRNSFVIKKPINMPNY 71 +SN + N +N NNN+ NK ++Y I P+ +P Y Sbjct: 323 LSNNYISNISNYNNNNNYNKKLYYNINYIEQIPVPVPVPIY 363 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 25.4 bits (53), Expect = 0.068 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -3 Query: 193 MSNLFFINDTNGNNNHLANK*VFYCFRNSFVIKKPINMPNY 71 +SN + N +N NN++ NK ++Y I P+ +P Y Sbjct: 85 LSNNYISNISNYNNDNNYNKKLYYNINYIEQIPVPVPVPIY 125 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 0.36 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -3 Query: 193 MSNLFFINDTNGNNNHLAN-K*VFYCFRNSFVIKKPINMPNY 71 +SN N+ N NNN+ N K ++Y + PI +P Y Sbjct: 85 LSNKTIHNNNNYNNNNYNNYKKLYYNINYIEQVPVPIPVPIY 126 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 0.63 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 172 NDTNGNNNHLANK*VFYCFRNSFVIKKPINMPNY 71 N+ N NNN+ K ++Y I P+ +P Y Sbjct: 95 NNYNNNNNYNNYKKLYYNINYIEQIPVPVPVPIY 128 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 0.63 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 172 NDTNGNNNHLANK*VFYCFRNSFVIKKPINMPNY 71 N+ N NNN+ K ++Y I P+ +P Y Sbjct: 95 NNYNNNNNYNNYKKLYYNINYIEQIPVPVPVPIY 128 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 0.63 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 172 NDTNGNNNHLANK*VFYCFRNSFVIKKPINMPNY 71 N+ N NNN+ K ++Y I P+ +P Y Sbjct: 95 NNYNNNNNYNNYKKLYYNINYIEQIPVPVPVPIY 128 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 0.63 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 172 NDTNGNNNHLANK*VFYCFRNSFVIKKPINMPNY 71 N+ N NNN+ K ++Y I P+ +P Y Sbjct: 95 NNYNNNNNYNNYKKLYYNINYIEQIPVPVPVPIY 128 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 0.63 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 172 NDTNGNNNHLANK*VFYCFRNSFVIKKPINMPNY 71 N+ N NNN+ K ++Y I P+ +P Y Sbjct: 95 NNYNNNNNYNNYKKLYYNINYIEQIPVPVPVPIY 128 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 0.63 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 172 NDTNGNNNHLANK*VFYCFRNSFVIKKPINMPNY 71 N+ N NNN+ K ++Y I P+ +P Y Sbjct: 95 NNYNNNNNYNNYKKLYYNINYIEQIPVPVPVPIY 128 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 0.63 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 172 NDTNGNNNHLANK*VFYCFRNSFVIKKPINMPNY 71 N+ N NNN+ K ++Y I P+ +P Y Sbjct: 95 NNYNNNNNYNNYKKLYYNINYIEQIPVPVPVPIY 128 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 0.84 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 172 NDTNGNNNHLANK*VFYCFRNSFVIKKPINMPNY 71 N+ N NNN+ K ++Y I P+ +P Y Sbjct: 95 NNYNNNNNYNNYKKLYYNINYIEQIPIPVPVPIY 128 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.4 bits (43), Expect = 1.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 100 IKKPINMPNYSYTPTIGR 47 +++P PNYS TIG+ Sbjct: 509 VRQPGKAPNYSVNWTIGQ 526 >M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H40. ). Length = 74 Score = 20.6 bits (41), Expect = 1.9 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = +2 Query: 116 KTVKYLFICEMVIISICI 169 KT +YL +CE + +++ + Sbjct: 28 KTTRYLSVCERLNLALSL 45 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 1.9 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -3 Query: 58 TIGRTYVYDNKYYKNLGC 5 ++ Y Y+N YK L C Sbjct: 84 SLSNNYNYNNNNYKKLYC 101 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 1.9 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -3 Query: 58 TIGRTYVYDNKYYKNLGC 5 ++ Y Y+N YK L C Sbjct: 84 SLSNNYNYNNNNYKKLYC 101 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 1.9 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -3 Query: 58 TIGRTYVYDNKYYKNLGC 5 ++ Y Y+N YK L C Sbjct: 84 SLSNNYNYNNNNYKKLYC 101 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 20.2 bits (40), Expect = 2.6 Identities = 10/19 (52%), Positives = 11/19 (57%), Gaps = 2/19 (10%) Frame = -1 Query: 75 IIHTPPPSG--VLTCTTIN 25 I+H PP S LT TT N Sbjct: 1362 IVHAPPHSPQITLTATTTN 1380 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 20.2 bits (40), Expect = 2.6 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -2 Query: 86 KYAELFIHPHHRAY 45 +Y++L +HPH RA+ Sbjct: 37 EYSDL-VHPHWRAF 49 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 19.4 bits (38), Expect = 4.5 Identities = 4/13 (30%), Positives = 9/13 (69%) Frame = +1 Query: 16 FCNIYCRTRKYAR 54 +C +YC +K+ + Sbjct: 212 YCRLYCYAQKHVK 224 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 19.4 bits (38), Expect = 4.5 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +1 Query: 100 LQNCYENSKILIYL 141 L+NC E K+L+ L Sbjct: 64 LRNCLEKLKVLVPL 77 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 19.4 bits (38), Expect = 4.5 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -1 Query: 84 ICRIIHTPPPSGVLTCT 34 +C HT P +L CT Sbjct: 158 VCEYDHTWWPYDILNCT 174 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 19.4 bits (38), Expect = 4.5 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -3 Query: 172 NDTNGNNNHLAN 137 N+ N NNN+ AN Sbjct: 244 NNNNNNNNNGAN 255 >AB083209-1|BAC54133.1| 87|Apis mellifera hypothetical protein protein. Length = 87 Score = 19.4 bits (38), Expect = 4.5 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 86 YRFFYY 103 YRFFYY Sbjct: 82 YRFFYY 87 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 19.0 bits (37), Expect = 5.9 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -3 Query: 193 MSNLFFINDTNGNNNHLAN 137 +SN N+ N NNN+ N Sbjct: 85 LSNKTIHNNNNYNNNNYNN 103 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 19.0 bits (37), Expect = 5.9 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +2 Query: 71 IIRHIYRFFYYKTVTKTVKYLFICEMV 151 IIR F+ + TV F+C +V Sbjct: 228 IIRRKTLFYTVNLILPTVLISFLCVLV 254 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 19.0 bits (37), Expect = 5.9 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -3 Query: 193 MSNLFFINDTNGNNNHLAN 137 +SN N+ N NNN+ N Sbjct: 318 LSNKTIHNNNNYNNNNYNN 336 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 18.6 bits (36), Expect = 7.8 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = -1 Query: 183 CFLLTIQMEIITISQINKY 127 C L TI+++ + S KY Sbjct: 130 CLLFTIELDRVLESPRGKY 148 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 18.6 bits (36), Expect = 7.8 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = -1 Query: 183 CFLLTIQMEIITISQINKY 127 C L TI+++ + S KY Sbjct: 145 CLLFTIELDRVLESPRGKY 163 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,401 Number of Sequences: 438 Number of extensions: 1167 Number of successful extensions: 31 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 146,343 effective HSP length: 45 effective length of database: 126,633 effective search space used: 2785926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 35 (18.9 bits)
- SilkBase 1999-2023 -