BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10d01 (721 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 2.9 S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 22 5.1 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 6.7 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 21 8.9 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 389 CEQVYPDKDFSLKLKR 436 CE+ YPD F++ L+R Sbjct: 219 CEEPYPDIVFNITLRR 234 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 22.2 bits (45), Expect = 5.1 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 398 VYPDKDFSLKLKRVINMF 451 V+P FSL L +V+++F Sbjct: 139 VHPSATFSLDLNKVVSVF 156 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +2 Query: 389 CEQVYPDKDFSLKLKR 436 C++ YPD F++ L+R Sbjct: 218 CDEPYPDIFFNITLRR 233 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.4 bits (43), Expect = 8.9 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -2 Query: 117 NTRNNMSRYKKMLFSFLSYTKLNMVSAPNNKYKFIFIP 4 N NN + Y K L+ ++Y + V P Y F P Sbjct: 96 NYNNNYNNYNKKLYYNINYIEQIPVPVPVPVYCGNFPP 133 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,654 Number of Sequences: 438 Number of extensions: 2983 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -