BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10c21 (303 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07719.1 68415.m00969 expressed protein 31 0.20 At4g14740.2 68417.m02267 expressed protein 27 1.8 At4g14740.1 68417.m02266 expressed protein 27 1.8 At2g28270.1 68415.m03431 DC1 domain-containing protein contains ... 27 1.8 At1g53340.1 68414.m06046 DC1 domain-containing protein contains ... 27 2.4 At4g15480.1 68417.m02366 UDP-glucoronosyl/UDP-glucosyl transfera... 27 3.2 At1g36670.1 68414.m04562 hypothetical protein 27 3.2 At3g50010.1 68416.m05468 DC1 domain-containing protein contains ... 26 4.2 At3g27473.1 68416.m03434 DC1 domain-containing protein contains ... 26 4.2 At1g20110.1 68414.m02516 zinc finger (FYVE type) family protein ... 26 4.2 At3g13620.1 68416.m01714 amino acid permease family protein weak... 26 5.6 At2g29050.1 68415.m03531 rhomboid family protein contains PFAM d... 26 5.6 At1g48820.1 68414.m05463 terpene synthase/cyclase family protein... 26 5.6 At5g03260.1 68418.m00275 laccase, putative / diphenol oxidase, p... 25 9.7 At4g16090.1 68417.m02439 hypothetical protein contains Pfam prof... 25 9.7 At2g39930.1 68415.m04907 isoamylase, putative / starch debranchi... 25 9.7 At2g17740.1 68415.m02055 DC1 domain-containing protein 25 9.7 >At2g07719.1 68415.m00969 expressed protein Length = 161 Score = 30.7 bits (66), Expect = 0.20 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -3 Query: 181 IFLGRCVKLIKLEKHTLCRGIVTIYFIAIITMFLC--LSSTVPK 56 IF G CV I LEK TL ++T +++ +F+ LSS K Sbjct: 24 IFSGSCVLFISLEKRTLTGYMLTFILYSVLALFVSVWLSSAAGK 67 >At4g14740.2 68417.m02267 expressed protein Length = 475 Score = 27.5 bits (58), Expect = 1.8 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +3 Query: 15 KVNTTIANIRIRRVFGTVDDKQRNIVIIAMKYIVTIP-RH 131 K+N + ++ R V GT K++NIV+ +K + P RH Sbjct: 384 KMNQVMLKMKSRHVGGTFTKKKKNIVLDVIKNVPAWPGRH 423 >At4g14740.1 68417.m02266 expressed protein Length = 475 Score = 27.5 bits (58), Expect = 1.8 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +3 Query: 15 KVNTTIANIRIRRVFGTVDDKQRNIVIIAMKYIVTIP-RH 131 K+N + ++ R V GT K++NIV+ +K + P RH Sbjct: 384 KMNQVMLKMKSRHVGGTFTKKKKNIVLDVIKNVPAWPGRH 423 >At2g28270.1 68415.m03431 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 248 Score = 27.5 bits (58), Expect = 1.8 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -2 Query: 110 IFHCNYYNVPLFVVNCPENTAYSYVSDGCIDFNSS 6 I H ++ N PL +++ P N +Y D C ++ S+ Sbjct: 67 IHHKSHTNHPLTLLHSPPNGLSTYTCDACGEYGSA 101 >At1g53340.1 68414.m06046 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 667 Score = 27.1 bits (57), Expect = 2.4 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = -2 Query: 227 PMYFPSNINTNKALTDFLRPLCETDQTRKTYAVPWNCNNIFHCNYYNVPL 78 P+++ N N N + DF+ C T + +Y V C + FH PL Sbjct: 111 PLFWCDNKNPN--IYDFICRACTTIEQGTSYYVCVTCGDQFHKECVGAPL 158 >At4g15480.1 68417.m02366 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 490 Score = 26.6 bits (56), Expect = 3.2 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -2 Query: 131 VPWNCNNIFHCNYYNVPLFVVNCPENTAYSYVSDGCIDF 15 +PW C+ N L+V +C +AY + DG + F Sbjct: 136 IPWVCHVAEEFNIPCAVLWVQSCACFSAYYHYQDGSVSF 174 >At1g36670.1 68414.m04562 hypothetical protein Length = 212 Score = 26.6 bits (56), Expect = 3.2 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 179 FLRPLCETDQTRKTYAVPWN 120 F L ET Q +KTY+ PW+ Sbjct: 111 FASKLEETSQNQKTYSTPWS 130 >At3g50010.1 68416.m05468 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 769 Score = 26.2 bits (55), Expect = 4.2 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -2 Query: 161 ETDQTRKTYAVPWNCNNIFHCNYYNVPLFVVNCPENTAYSYVSDGC 24 E + R V W NN +HC N F ++ E+T + ++ GC Sbjct: 210 ENGRFRVLEDVSWRTNNKWHCLSVNWRTFKLSREEDTLH-FICIGC 254 >At3g27473.1 68416.m03434 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 662 Score = 26.2 bits (55), Expect = 4.2 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = -2 Query: 173 RPLCETDQTR--KTYAVPWNCNNIFHCNYY 90 RPLC T R + + NNIF C+YY Sbjct: 612 RPLCSTCHCRCPGPFILNKERNNIFFCSYY 641 >At1g20110.1 68414.m02516 zinc finger (FYVE type) family protein contains Pfam profile: PF01363 FYVE zinc finger Length = 601 Score = 26.2 bits (55), Expect = 4.2 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +2 Query: 80 KEHCNNCNEIYCYNSTAQRM 139 + HC NC +++C T R+ Sbjct: 474 RHHCRNCGDVFCDKCTQGRI 493 >At3g13620.1 68416.m01714 amino acid permease family protein weak similarity to SP|Q9WTR6 Cystine/glutamate transporter (Amino acid transport system xc-) {Mus musculus}; contains Pfam profile PF00324: Amino acid permease Length = 478 Score = 25.8 bits (54), Expect = 5.6 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 161 ETDQTRKTYAVPWNCNNIFHCNYYNVPLFVV 69 E D+ +KT+ + IF C Y +PLF V Sbjct: 232 EVDEPQKTFPLALLIAVIFTCVAYLIPLFAV 262 >At2g29050.1 68415.m03531 rhomboid family protein contains PFAM domain PF01694, Rhomboid family Length = 389 Score = 25.8 bits (54), Expect = 5.6 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 128 PWNCNNIFHCNY--YNVPLFVVNCPENTAY 45 PW I N + + +F+ NCP+N+AY Sbjct: 56 PWLVPAIVVANIALFAISMFINNCPKNSAY 85 >At1g48820.1 68414.m05463 terpene synthase/cyclase family protein similar to terpene cyclase GI:9293912 from [Arabidopsis thaliana] Length = 561 Score = 25.8 bits (54), Expect = 5.6 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +3 Query: 48 RRVFGTVDDKQ-RNI-VIIAMKYIVTIPRHSVCFSSLISFTQRPKKICQ 188 RR+ +D Q +N+ +I+AMKYI C +L+ F + K Q Sbjct: 218 RRIRKALDQPQHKNMEIIVAMKYIQFYEEEEDCDKTLLKFAKLNFKFLQ 266 >At5g03260.1 68418.m00275 laccase, putative / diphenol oxidase, putative similar to laccase [Pinus taeda][GI:13661207] Length = 557 Score = 25.0 bits (52), Expect = 9.7 Identities = 9/43 (20%), Positives = 20/43 (46%) Frame = -2 Query: 158 TDQTRKTYAVPWNCNNIFHCNYYNVPLFVVNCPENTAYSYVSD 30 T+ + ++ W+ + + + P ++ CP T SY+ D Sbjct: 71 TNHVQYNMSIHWHGLKQYRNGWADGPAYITQCPIQTGQSYLYD 113 >At4g16090.1 68417.m02439 hypothetical protein contains Pfam profile PF03478: Protein of unknown function (DUF295) Length = 251 Score = 25.0 bits (52), Expect = 9.7 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -2 Query: 239 PLGKPMYFPSNINTNKALTDFLRPLCETDQTRKTYAVPWNC 117 PLGKP+ TN A+T C DQ+ K +AV C Sbjct: 126 PLGKPIAIQQQAITNAAMT------CSPDQS-KDFAVAVKC 159 >At2g39930.1 68415.m04907 isoamylase, putative / starch debranching enzyme, putative similar to isoamylase from [Solanum tuberosum] GI:27728145, [Triticum aestivum] GI:17932898, [Hordeum vulgare] GI:21314275, [Oryza sativa] GI:3252794; contains Pfam profiles PF00128: Alpha amylase catalytic domain, PF02922: Isoamylase N-terminal domain Length = 783 Score = 25.0 bits (52), Expect = 9.7 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 119 CNNIFHCNYYNVPLFVVNC 63 C N F+CN+ V F+++C Sbjct: 376 CGNTFNCNHPVVRQFILDC 394 >At2g17740.1 68415.m02055 DC1 domain-containing protein Length = 248 Score = 25.0 bits (52), Expect = 9.7 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = -2 Query: 110 IFHCNYYNVPLFVVNCPENTAYSYVSDGCIDFNS 9 I H ++ + PL ++ P+N +Y D C ++ S Sbjct: 63 IRHKSHPDHPLILLYSPQNNNSTYTCDACGEYGS 96 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,238,415 Number of Sequences: 28952 Number of extensions: 93764 Number of successful extensions: 308 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 305 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 308 length of database: 12,070,560 effective HSP length: 70 effective length of database: 10,043,920 effective search space used: 301317600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -