BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10c19 (718 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 26 1.3 AJ496389-1|CAD43035.1| 103|Anopheles gambiae mannosyl glycoprot... 25 3.1 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 25.8 bits (54), Expect = 1.3 Identities = 10/42 (23%), Positives = 23/42 (54%) Frame = +1 Query: 538 SAEYGCKPIEGMLSHQLKQFRIDGEKSIILNPSEAQRKEHEK 663 S + +P+ GML Q +Q R ++++ + QR++ ++ Sbjct: 60 SGTHSDRPVAGMLQQQQQQQRQPQRQAVVGTQQQQQRRQQQQ 101 >AJ496389-1|CAD43035.1| 103|Anopheles gambiae mannosyl glycoprotein transferase protein. Length = 103 Score = 24.6 bits (51), Expect = 3.1 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -1 Query: 436 QHVQRLHFHPQLLYELQQL*IHQCEHQDLSW 344 +H + F+ + YE+ + H CE+ D +W Sbjct: 65 KHNMGMAFNRTMWYEIVRCARHFCEYDDYNW 95 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.317 0.133 0.373 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 706,363 Number of Sequences: 2352 Number of extensions: 13964 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -