BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10c17 (740 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transf... 135 1e-33 AY070254-1|AAL59653.1| 225|Anopheles gambiae glutathione S-tran... 42 2e-05 AF071163-1|AAC79999.1| 218|Anopheles gambiae glutathione S-tran... 37 6e-04 AF071160-4|AAC79992.1| 218|Anopheles gambiae glutathione S-tran... 37 6e-04 Z81292-1|CAB03593.1| 209|Anopheles gambiae GSTD1-6 protein prot... 35 0.002 Z71481-1|CAA96105.1| 140|Anopheles gambiae GSTD2 protein protein. 35 0.002 AF071160-1|AAC79995.1| 209|Anopheles gambiae glutathione S-tran... 35 0.002 AF515527-1|AAM61894.1| 211|Anopheles gambiae glutathione S-tran... 34 0.005 AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-tran... 27 0.80 AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-tran... 27 0.80 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 26 1.4 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 26 1.4 AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transpo... 26 1.4 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 23 9.9 DQ007318-1|AAY24700.1| 153|Anopheles gambiae lysozyme c-4 protein. 23 9.9 >AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transferase o1 protein. Length = 248 Score = 135 bits (327), Expect = 1e-33 Identities = 72/168 (42%), Positives = 101/168 (60%), Gaps = 8/168 (4%) Frame = +1 Query: 223 KHLQTGDVLP--PYSGKLRVFAMRFCPYAERTVLTLNAKNIPYDLVFINLDQKPEWIFNF 396 KHL G P P GKLR+++MRFCPYA+R L L+AK IPY ++INL +KPEW Sbjct: 5 KHLAKGSSPPSLPDDGKLRLYSMRFCPYAQRVHLMLDAKKIPYHAIYINLSEKPEWYLEK 64 Query: 397 SPKGTVPALEYEPGK---ALFDSNIINVYLDEKY--PEIPLQASDPLRRAQDKILVESFA 561 +P G VPALE PGK L++S +++ Y++E Y + L +DP +AQD+IL+E FA Sbjct: 65 NPLGKVPALEI-PGKEGVTLYESLVLSDYIEEAYSAQQRKLYPADPFSKAQDRILIERFA 123 Query: 562 PAQ-SAYYTAAFNAQALEPSMVETYHKGLEGLQKELETRSTKYLHGGR 702 + YY F A + P + + GL+ +KEL+ R T Y G + Sbjct: 124 GSVIGPYYRILFAADGIPPGAITEFGAGLDIFEKELKARGTPYFGGDK 171 Score = 24.2 bits (50), Expect = 4.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 653 YKKSLKRAVLNIYMGDEPGWVDY 721 ++K LK + GD+PG +DY Sbjct: 155 FEKELKARGTPYFGGDKPGMIDY 177 >AY070254-1|AAL59653.1| 225|Anopheles gambiae glutathione S-transferase E4 protein. Length = 225 Score = 41.9 bits (94), Expect = 2e-05 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 6/95 (6%) Frame = +1 Query: 268 LRVFAMRFCPYAERTVLTLNAKNIPYDLVFINL---DQKPEWIFNFSPKGTVPALEYEPG 438 ++++ + P LT A + D+V INL + E +P+ T+P ++ + G Sbjct: 4 IKLYTAKLSPPGRSVELTAKALGLELDIVPINLLAQEHLTEAFRKLNPQHTIPLID-DNG 62 Query: 439 KALFDSNIINVYLDEKY--PE-IPLQASDPLRRAQ 534 ++DS+ INVYL KY PE L SD ++RA+ Sbjct: 63 TIVWDSHAINVYLVSKYGKPEGDSLYPSDVVQRAK 97 >AF071163-1|AAC79999.1| 218|Anopheles gambiae glutathione S-transferase D1-3 protein. Length = 218 Score = 37.1 bits (82), Expect = 6e-04 Identities = 39/124 (31%), Positives = 57/124 (45%), Gaps = 15/124 (12%) Frame = +1 Query: 373 KPEWIFNFSPKGTVPALEYEPGKALFDSNIINVYLDEKY----PEIP--LQASDPLRRA- 531 KPE++ +P+ +P L E G L++S I +YL EKY P + L DP RRA Sbjct: 40 KPEFL-KLNPQHCIPTLVDEDGFVLWESRAIQIYLVEKYCAHDPALAERLYPGDPRRRAV 98 Query: 532 -------QDKILVESFAPAQSAYYTAAFNAQ-ALEPSMVETYHKGLEGLQKELETRSTKY 687 IL + FA YY F + A +P + + + LE L LE ++ Sbjct: 99 VHQRLFFDVAILYQRFA---EYYYPQIFGKKVAGDPDRLRSMEQALEFLNTFLE--GERF 153 Query: 688 LHGG 699 + GG Sbjct: 154 VAGG 157 >AF071160-4|AAC79992.1| 218|Anopheles gambiae glutathione S-transferase protein. Length = 218 Score = 37.1 bits (82), Expect = 6e-04 Identities = 39/124 (31%), Positives = 57/124 (45%), Gaps = 15/124 (12%) Frame = +1 Query: 373 KPEWIFNFSPKGTVPALEYEPGKALFDSNIINVYLDEKY----PEIP--LQASDPLRRA- 531 KPE++ +P+ +P L E G L++S I +YL EKY P + L DP RRA Sbjct: 40 KPEFL-KLNPQHCIPTLVDEDGFVLWESRAIQIYLVEKYCAHDPALAERLYPGDPRRRAV 98 Query: 532 -------QDKILVESFAPAQSAYYTAAFNAQ-ALEPSMVETYHKGLEGLQKELETRSTKY 687 IL + FA YY F + A +P + + + LE L LE ++ Sbjct: 99 VHQRLFFDVAILYQRFA---EYYYPQIFGKKVAGDPDRLRSMEQALEFLNTFLE--GERF 153 Query: 688 LHGG 699 + GG Sbjct: 154 VAGG 157 >Z81292-1|CAB03593.1| 209|Anopheles gambiae GSTD1-6 protein protein. Length = 209 Score = 35.1 bits (77), Expect = 0.002 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +1 Query: 373 KPEWIFNFSPKGTVPALEYEPGKALFDSNIINVYLDEKY-PEIPLQASDPLRRA 531 KPE++ +P+ +P L + G AL++S I +YL EKY + L DP +RA Sbjct: 40 KPEFL-KLNPQHCIPTL-VDNGFALWESRAIQIYLAEKYGKDDKLYPKDPQKRA 91 >Z71481-1|CAA96105.1| 140|Anopheles gambiae GSTD2 protein protein. Length = 140 Score = 35.1 bits (77), Expect = 0.002 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +1 Query: 373 KPEWIFNFSPKGTVPALEYEPGKALFDSNIINVYLDEKY-PEIPLQASDPLRRA 531 KPE++ +P+ +P L + G AL++S I +YL EKY + L DP +RA Sbjct: 40 KPEFL-KLNPQHCIPTL-VDNGFALWESRAIQIYLAEKYGKDDKLYPKDPQKRA 91 >AF071160-1|AAC79995.1| 209|Anopheles gambiae glutathione S-transferase protein. Length = 209 Score = 35.1 bits (77), Expect = 0.002 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +1 Query: 373 KPEWIFNFSPKGTVPALEYEPGKALFDSNIINVYLDEKY-PEIPLQASDPLRRA 531 KPE++ +P+ +P L + G AL++S I +YL EKY + L DP +RA Sbjct: 40 KPEFL-KLNPQHCIPTL-VDNGFALWESRAIQIYLAEKYGKDDKLYPKDPQKRA 91 >AF515527-1|AAM61894.1| 211|Anopheles gambiae glutathione S-transferase D10 protein. Length = 211 Score = 33.9 bits (74), Expect = 0.005 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 3/64 (4%) Frame = +1 Query: 307 RTVLTLNAK-NIPYDLVFIN--LDQKPEWIFNFSPKGTVPALEYEPGKALFDSNIINVYL 477 ++VL + K I +DL +N L + E + F+P+ T+P E G +++S I +YL Sbjct: 13 QSVLLVGKKLGITFDLKEVNPHLPEVREQLRKFNPQHTIPTF-IEDGHVIWESYAIAIYL 71 Query: 478 DEKY 489 EKY Sbjct: 72 VEKY 75 >AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-transferase D5 protein. Length = 216 Score = 26.6 bits (56), Expect = 0.80 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +1 Query: 397 SPKGTVPALEYEPGKALFDSNIINVYLDEKY-PEIPLQASDPLRRA 531 +P+ +P + G +++S I +YL EKY + L DP R+ Sbjct: 46 NPQHLIPTFVEDDGHVIWESYAIAIYLVEKYGQDDALYPKDPKVRS 91 >AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-transferase D12 protein. Length = 211 Score = 26.6 bits (56), Expect = 0.80 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +1 Query: 397 SPKGTVPALEYEPGKALFDSNIINVYLDEKY 489 +P+ T+P L + G L++S I +YL EKY Sbjct: 46 NPQHTIPTL-VDNGHILWESYAILIYLAEKY 75 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 25.8 bits (54), Expect = 1.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 118 LTSIISIKRHQKATLHVDTNLF 183 L + + IK+H HVDT LF Sbjct: 20 LDTFVQIKQHYTTKYHVDTGLF 41 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 25.8 bits (54), Expect = 1.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 118 LTSIISIKRHQKATLHVDTNLF 183 L + + IK+H HVDT LF Sbjct: 20 LDTFVQIKQHYTTKYHVDTGLF 41 >AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transporter Ag_AAT8 protein. Length = 636 Score = 25.8 bits (54), Expect = 1.4 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = +1 Query: 259 SGKLRVFAMRFCPYAERTVLTLNAKNIPYDLVFINLDQKPEWIFNFSPK 405 SGK F F PY VL + A +P + I KP+W + PK Sbjct: 278 SGKASYFLALF-PYVVMAVLLVRACTLPGAVDGIVYFLKPQWDKIYDPK 325 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 641 DLRDYKKSLKRAVLNIYMGDEPGWVDYTPLAI 736 D D+K + LN+Y G PGWV T + Sbjct: 3 DTNDWKMFIPP--LNLYDGYGPGWVLLTDAVV 32 >DQ007318-1|AAY24700.1| 153|Anopheles gambiae lysozyme c-4 protein. Length = 153 Score = 23.0 bits (47), Expect = 9.9 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -3 Query: 171 VYVKCSLLMSFDR 133 VY KCSL +FDR Sbjct: 33 VYEKCSLARTFDR 45 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 745,196 Number of Sequences: 2352 Number of extensions: 15575 Number of successful extensions: 85 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76091949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -