BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10c16 (682 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1565.03 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 27 2.5 SPAC23A1.14c |||cystathionine gamma-synthase |Schizosaccharomyce... 26 4.4 SPAC23H4.14 |vam6|vps39|guanyl-nucleotide exchange factor Vma6|S... 26 4.4 >SPAC1565.03 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 166 Score = 27.1 bits (57), Expect = 2.5 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +2 Query: 122 NFLTWPVADWKELVQYLPELKVFLAEEQ*NLMTDPCGLMYTKLSLQSPN 268 NF + + KEL+ + P+++VFL P YT + + PN Sbjct: 113 NFYSSSESSEKELIWFQPKMRVFLQSLSNMSYLSPSKFRYTTVYSKQPN 161 >SPAC23A1.14c |||cystathionine gamma-synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 398 Score = 26.2 bits (55), Expect = 4.4 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +2 Query: 392 KVMKLKQNVLYSNTIN*KQKAFLKMKSLR 478 K++ LK + Y TI Q+AFL ++SLR Sbjct: 232 KILDLKADRAYLGTILHPQQAFLLLRSLR 260 >SPAC23H4.14 |vam6|vps39|guanyl-nucleotide exchange factor Vma6|Schizosaccharomyces pombe|chr 1|||Manual Length = 905 Score = 26.2 bits (55), Expect = 4.4 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -2 Query: 285 RTCIFRFGDWRESFVYIKPQGSVIRFHCSSAKKTFNS 175 +TC+F +S + I P GSV+ + C AKK +S Sbjct: 863 KTCLFCHKRLGKSVISIFPDGSVVHYGC--AKKYVSS 897 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,567,365 Number of Sequences: 5004 Number of extensions: 51870 Number of successful extensions: 152 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 152 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 313902888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -