SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc10c13
         (359 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667195-1|ABG75747.1|  469|Apis mellifera cys-loop ligand-gated...    20   7.7  
DQ244075-1|ABB36785.1|  548|Apis mellifera cytochrome P450 monoo...    20   7.7  

>DQ667195-1|ABG75747.1|  469|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 469

 Score = 20.2 bits (40), Expect = 7.7
 Identities = 9/36 (25%), Positives = 17/36 (47%)
 Frame = -1

Query: 161 VILLQDIHIGRILIFECDMTIYHIFCITYGSYFGAY 54
           +IL  ++H+    + E  +    IF  T   Y+G +
Sbjct: 179 IILADELHLTEYKLVEKWVNSSEIFYTTSQQYYGHF 214


>DQ244075-1|ABB36785.1|  548|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 548

 Score = 20.2 bits (40), Expect = 7.7
 Identities = 6/13 (46%), Positives = 10/13 (76%)
 Frame = +1

Query: 106 ISHSKIKMRPMWI 144
           + H+KI +RP W+
Sbjct: 222 LRHTKIWLRPDWL 234


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 93,545
Number of Sequences: 438
Number of extensions: 1961
Number of successful extensions: 7
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  8432340
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

- SilkBase 1999-2023 -