BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10c12 (342 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 25 0.16 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 25 0.16 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 25 0.16 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 25 0.16 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 24 0.50 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 3.5 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 3.5 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 3.5 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 3.5 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 20 8.1 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 20 8.1 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 20 8.1 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 20 8.1 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 25.4 bits (53), Expect = 0.16 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 219 LLSQPGCWSTSSITATSNKIITKKYVVYSVLSK 317 +L PGC+S A +K + KKY S +K Sbjct: 224 VLCSPGCFSLFRGKALMDKSVMKKYTTRSTQAK 256 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 25.4 bits (53), Expect = 0.16 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 219 LLSQPGCWSTSSITATSNKIITKKYVVYSVLSK 317 +L PGC+S A +K + KKY S +K Sbjct: 538 VLCSPGCFSLFRGKALMDKSVMKKYTTRSTQAK 570 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 25.4 bits (53), Expect = 0.16 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 219 LLSQPGCWSTSSITATSNKIITKKYVVYSVLSK 317 +L PGC+S A +K + KKY S +K Sbjct: 771 VLCSPGCFSLFRGKALMDKSVMKKYTTRSTQAK 803 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 25.4 bits (53), Expect = 0.16 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 219 LLSQPGCWSTSSITATSNKIITKKYVVYSVLSK 317 +L PGC+S A +K + KKY S +K Sbjct: 771 VLCSPGCFSLFRGKALMDKSVMKKYTTRSTQAK 803 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 23.8 bits (49), Expect = 0.50 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 74 IRNLLRANNQIFKNVAQQRNMSVICTPPRNKVSR 175 +RNL + F+NVA+ R + + C N + R Sbjct: 207 LRNLDKIVTNGFRNVAESRKIFIECIEQYNVILR 240 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 3.5 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 219 LLSQPGCWSTSSITATSNKIITKKYVVYS 305 +L PGC+S A + + KKY S Sbjct: 798 VLCSPGCFSLFRGKALMDDNVMKKYTTSS 826 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 3.5 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 219 LLSQPGCWSTSSITATSNKIITKKYVVYS 305 +L PGC+S A + + KKY S Sbjct: 798 VLCSPGCFSLFRGKALMDDNVMKKYTTSS 826 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 3.5 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 219 LLSQPGCWSTSSITATSNKIITKKYVVYS 305 +L PGC+S A + + KKY S Sbjct: 798 VLCSPGCFSLFRGKALMDDNVMKKYTTSS 826 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 3.5 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 219 LLSQPGCWSTSSITATSNKIITKKYVVYS 305 +L PGC+S A + + KKY S Sbjct: 798 VLCSPGCFSLFRGKALMDDNVMKKYTTSS 826 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 19.8 bits (39), Expect = 8.1 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -1 Query: 231 AGIADQ-PTTIRPARKIISPLETLFL 157 A A Q P+T R A K +S +ETL L Sbjct: 118 AAFAPQGPSTGRGASKKLSKVETLRL 143 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 19.8 bits (39), Expect = 8.1 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 298 TTYFFVIILLLVAVMLDVDQHPGW 227 T Y+F+ + LL+ ++ V + W Sbjct: 318 TVYYFISLGLLILRLVSVCFYGSW 341 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 19.8 bits (39), Expect = 8.1 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +3 Query: 36 TSKNNCTKTKCLELG 80 T+ +CT+T C+ G Sbjct: 22 TNDEDCTETSCMNGG 36 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 19.8 bits (39), Expect = 8.1 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = -3 Query: 211 HHHQAGEEDH 182 HHH AG H Sbjct: 322 HHHHAGHHIH 331 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,985 Number of Sequences: 336 Number of extensions: 1631 Number of successful extensions: 14 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 6664455 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -