BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10c11 (718 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26467| Best HMM Match : PKD (HMM E-Value=1.1e-06) 29 3.8 SB_41464| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 >SB_26467| Best HMM Match : PKD (HMM E-Value=1.1e-06) Length = 1826 Score = 29.1 bits (62), Expect = 3.8 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 1/65 (1%) Frame = +2 Query: 89 LVASYY*KCTIFIL*YNIIIYSDYRYRPTIHTTTDSMV*GKE*RSPLRV-YTYT*YIQDV 265 L A +Y TI++ YN++ Y +H T ++V + + + T+T I D Sbjct: 400 LAAPWYETYTIYVTAYNLVSNVTKAYTAIVHKTVKNLVLTNDGPTKQNLTMTFTLTIGDF 459 Query: 266 DTNTC 280 T+TC Sbjct: 460 GTDTC 464 >SB_41464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 28.7 bits (61), Expect = 5.0 Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = -2 Query: 303 GVELIVSTQVLVSTSC-IYYVYVYTLRGDL 217 GV++I+STQV + C +Y+V + ++ DL Sbjct: 36 GVQMIMSTQVALQVVCYVYFVILIDIKDDL 65 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,344,321 Number of Sequences: 59808 Number of extensions: 296016 Number of successful extensions: 396 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 396 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -