BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10c09 (662 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-b... 26 0.92 AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein p... 25 1.6 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 25 2.8 DQ370035-1|ABD18596.1| 93|Anopheles gambiae defensin protein. 24 4.9 AY973195-1|AAY41589.1| 80|Anopheles gambiae defensin 2 protein. 24 4.9 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 23 8.6 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 23 8.6 AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 23 8.6 >AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-binding protein OBPjj10 protein. Length = 207 Score = 26.2 bits (55), Expect = 0.92 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 535 RRHASAARNVLPPRRRNCCRPSLEKTKPR 621 R HASA + PR R+ C + T+ R Sbjct: 67 RMHASARKRAYCPRTRSACAETFPSTRRR 95 >AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein protein. Length = 429 Score = 25.4 bits (53), Expect = 1.6 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 217 LVSAKTQKHVERVVTVALVREEVQPMRVCHRRN 315 ++ K Q++ ER +A REE++ MR H R+ Sbjct: 31 ILMTKQQEYTERRELIA--REEMEKMRAAHERD 61 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 24.6 bits (51), Expect = 2.8 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +3 Query: 84 CGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKP 197 CG K++ +DP E+ +R+M K+ ++ K+P Sbjct: 1179 CGSKQLDIDP---QEVVGGAGACGVRRMAKEKMLRKRP 1213 >DQ370035-1|ABD18596.1| 93|Anopheles gambiae defensin protein. Length = 93 Score = 23.8 bits (49), Expect = 4.9 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -1 Query: 287 CTSSLTKATVTTLSTCFCVFADTSAGVYC 201 C +++ TVT STC AD + + C Sbjct: 27 CAIAVSGTTVTLQSTCKLFTADVVSSITC 55 >AY973195-1|AAY41589.1| 80|Anopheles gambiae defensin 2 protein. Length = 80 Score = 23.8 bits (49), Expect = 4.9 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -1 Query: 287 CTSSLTKATVTTLSTCFCVFADTSAGVYC 201 C +++ TVT STC AD + + C Sbjct: 14 CAIAVSGTTVTLQSTCKLFTADVVSSITC 42 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 23.0 bits (47), Expect = 8.6 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 135 NTNSRQNIRKMIKDGLVIKKPVAVHSRARVR 227 N ++ +R IK+GL + +PVA + RA R Sbjct: 370 NMHNLPYLRACIKEGLRMYQPVAGNMRAAGR 400 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 23.0 bits (47), Expect = 8.6 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +1 Query: 19 DLTVSG*VPSSCRRGLQPLLCDVVKR 96 +LT+ VP+ C G Q +C ++K+ Sbjct: 1107 ELTIHRYVPARCGAGCQDRVCILLKK 1132 >AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease protein. Length = 364 Score = 23.0 bits (47), Expect = 8.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -3 Query: 576 SWRQYVPRGACVPPSLYCGGP 514 SW VP GA V SL G P Sbjct: 10 SWCSLVPLGATVGQSLNSGDP 30 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 689,636 Number of Sequences: 2352 Number of extensions: 13861 Number of successful extensions: 46 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66068490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -