Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc10c08
         (608 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g28780.1 68417.m04115 GDSL-motif lipase/hydrolase family prot...    29   3.2  

>At4g28780.1 68417.m04115 GDSL-motif lipase/hydrolase family protein
           similar to family II lipase EXL3 (GI:15054386), EXL1
           (GI:15054382), EXL2 (GI:15054384) [Arabidopsis
           thaliana]; contains Pfam profile PF00657:
           Lipase/Acylhydrolase with GDSL-like motif
          Length = 367

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 17/45 (37%), Positives = 23/45 (51%)
 Frame = +2

Query: 113 LYQLMFRLLMKLGTDILGSVQSKIMKTLDVIHECFPAELQLHNIF 247
           LY+L  R +M  GT  LG V +++  +  V  EC P   Q   IF
Sbjct: 207 LYELGARRVMVTGTGPLGCVPAELASSGSVNGECAPEAQQAAAIF 251


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,008,750
Number of Sequences: 28952
Number of extensions: 88250
Number of successful extensions: 236
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 230
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 236
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1216725696
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)