BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10c08 (608 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28780.1 68417.m04115 GDSL-motif lipase/hydrolase family prot... 29 3.2 >At4g28780.1 68417.m04115 GDSL-motif lipase/hydrolase family protein similar to family II lipase EXL3 (GI:15054386), EXL1 (GI:15054382), EXL2 (GI:15054384) [Arabidopsis thaliana]; contains Pfam profile PF00657: Lipase/Acylhydrolase with GDSL-like motif Length = 367 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = +2 Query: 113 LYQLMFRLLMKLGTDILGSVQSKIMKTLDVIHECFPAELQLHNIF 247 LY+L R +M GT LG V +++ + V EC P Q IF Sbjct: 207 LYELGARRVMVTGTGPLGCVPAELASSGSVNGECAPEAQQAAAIF 251 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,008,750 Number of Sequences: 28952 Number of extensions: 88250 Number of successful extensions: 236 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 230 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 236 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1216725696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -