BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10c06 (728 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 24 1.4 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 22 5.8 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 5.8 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 22 5.8 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 7.7 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.8 bits (49), Expect = 1.4 Identities = 30/111 (27%), Positives = 54/111 (48%), Gaps = 2/111 (1%) Frame = +2 Query: 179 RGIKAKIFNKERRNEKIQMKKKIKAHEEKNVKHNTEKVAEGALPVYLLDRDVQSRAKVLS 358 RG K + KE + E ++ + KIK + VK +++ + P+ L+ + R K LS Sbjct: 175 RGTKIVLHMKEDQTEFLE-EHKIK----EIVKKHSQFIG---YPIKLVVE--KEREKELS 224 Query: 359 N-MIKQKRKEKAGK-WDVPIPKVRAQADAEVFKVLKSGKSKRKAWKRMVTK 505 + ++++KE+ G+ D PK+ + E K K K+K K T+ Sbjct: 225 DDEAEEEKKEEEGEDKDKDKPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTE 275 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 21.8 bits (44), Expect = 5.8 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = +3 Query: 279 TQRRSPKVPCLFIYWTGMFN 338 T+ ++ K+ C F W G N Sbjct: 19 TEAKTDKILCFFASWAGYRN 38 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/47 (23%), Positives = 21/47 (44%) Frame = +2 Query: 458 KSGKSKRKAWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKKAHV 598 KS K K W+R++ FV PK + ++ + + + H+ Sbjct: 580 KSAKPMLKPWQRVLPDGVFVAFLLKHIVPKLQLCMQNLVINPHQQHL 626 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -3 Query: 69 YSFCGMLVAYSATYAVTIPQ 10 ++FC M++A TY V + Q Sbjct: 352 WTFCHMMIAALTTYLVILIQ 371 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.4 bits (43), Expect = 7.7 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 205 IEYFSFDTAEFARLFSAFMRLTSFTLPFS 119 I F D EFA L + + TSF P S Sbjct: 287 ISQFQLDAHEFACLRAIVLFKTSFEKPSS 315 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,135 Number of Sequences: 336 Number of extensions: 2928 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -