BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10c05 (651 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16796| Best HMM Match : Multi_Drug_Res (HMM E-Value=0.96) 30 1.9 SB_57766| Best HMM Match : MFS_1 (HMM E-Value=2.4e-14) 28 5.7 >SB_16796| Best HMM Match : Multi_Drug_Res (HMM E-Value=0.96) Length = 725 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = -3 Query: 181 NVLCIEISGYYNYQPHNVLYKCSISRSQTLVARVIWTHSERKTL 50 N C G++ + Y C S + L+ RVI+T S +T+ Sbjct: 635 NYACATDDGFHRLSASYIPYLCCFSSATDLICRVIFTTSPNRTV 678 >SB_57766| Best HMM Match : MFS_1 (HMM E-Value=2.4e-14) Length = 499 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -3 Query: 160 SGYYNYQPHNVLYKCSISRSQTLVARVIWTHSERKTL 50 SG++ + Y C S + L+ RVI+T S +T+ Sbjct: 215 SGFHRLSASYIPYLCCFSSATDLICRVIFTTSPNRTV 251 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,235,461 Number of Sequences: 59808 Number of extensions: 375045 Number of successful extensions: 916 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 826 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 915 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -