BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10c03 (515 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g47370.2 68416.m05151 40S ribosomal protein S20 (RPS20B) 40S ... 176 6e-45 At3g47370.1 68416.m05150 40S ribosomal protein S20 (RPS20B) 40S ... 176 6e-45 At5g62300.1 68418.m07821 40S ribosomal protein S20 (RPS20C) ribo... 174 3e-44 At3g45030.1 68416.m04851 40S ribosomal protein S20 (RPS20A) 40S ... 174 3e-44 At3g13120.1 68416.m01642 30S ribosomal protein S10, chloroplast,... 57 6e-09 At1g20530.1 68414.m02558 hypothetical protein 30 1.1 At3g13150.1 68416.m01645 pentatricopeptide (PPR) repeat-containi... 27 5.7 At3g18310.1 68416.m02330 expressed protein 27 7.5 At5g47370.1 68418.m05838 homeobox-leucine zipper protein 2 (HAT2... 27 9.9 At5g27220.1 68418.m03247 protein transport protein-related low s... 27 9.9 >At3g47370.2 68416.m05151 40S ribosomal protein S20 (RPS20B) 40S RIBOSOMAL PROTEIN S20 - ARABIDOPSIS THALIANA,PID:g1350956 Length = 122 Score = 176 bits (429), Expect = 6e-45 Identities = 78/109 (71%), Positives = 97/109 (88%) Frame = +3 Query: 150 QAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTPC 329 +A + IH+IRITL+S+NV++LEKVC DL+ GAK ++LRVKGPVRMPTK+L+ITTRK PC Sbjct: 14 EAPLEQIHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAPC 73 Query: 330 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIADA 476 GEG+ TWDRF++R+HKRVIDL S ++VKQITSI IEPGVEVEVTIAD+ Sbjct: 74 GEGTNTWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >At3g47370.1 68416.m05150 40S ribosomal protein S20 (RPS20B) 40S RIBOSOMAL PROTEIN S20 - ARABIDOPSIS THALIANA,PID:g1350956 Length = 122 Score = 176 bits (429), Expect = 6e-45 Identities = 78/109 (71%), Positives = 97/109 (88%) Frame = +3 Query: 150 QAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTPC 329 +A + IH+IRITL+S+NV++LEKVC DL+ GAK ++LRVKGPVRMPTK+L+ITTRK PC Sbjct: 14 EAPLEQIHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAPC 73 Query: 330 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIADA 476 GEG+ TWDRF++R+HKRVIDL S ++VKQITSI IEPGVEVEVTIAD+ Sbjct: 74 GEGTNTWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >At5g62300.1 68418.m07821 40S ribosomal protein S20 (RPS20C) ribosomal protein S20, Arabidopsis thaliana, PIR:T12992 Length = 124 Score = 174 bits (424), Expect = 3e-44 Identities = 77/103 (74%), Positives = 94/103 (91%) Frame = +3 Query: 168 IHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTPCGEGSKT 347 IH+IRITL+S+NV++LEKVC DL+ GAK ++LRVKGPVRMPTK+L+ITTRK PCGEG+ T Sbjct: 22 IHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAPCGEGTNT 81 Query: 348 WDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIADA 476 WDRF++R+HKRVIDL S ++VKQITSI IEPGVEVEVTIAD+ Sbjct: 82 WDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 124 >At3g45030.1 68416.m04851 40S ribosomal protein S20 (RPS20A) 40S ribsomomal proteinS20, Arabidopsis thaliana, pir:T12992 Length = 124 Score = 174 bits (424), Expect = 3e-44 Identities = 77/103 (74%), Positives = 94/103 (91%) Frame = +3 Query: 168 IHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTPCGEGSKT 347 IH+IRITL+S+NV++LEKVC DL+ GAK ++LRVKGPVRMPTK+L+ITTRK PCGEG+ T Sbjct: 22 IHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAPCGEGTNT 81 Query: 348 WDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIADA 476 WDRF++R+HKRVIDL S ++VKQITSI IEPGVEVEVTIAD+ Sbjct: 82 WDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 124 >At3g13120.1 68416.m01642 30S ribosomal protein S10, chloroplast, putative similar to 30S ribosomal protein S10 GB:P02364 [Escherichia coli] (est matches suggest the N-terminal extension) Length = 191 Score = 57.2 bits (132), Expect = 6e-09 Identities = 34/120 (28%), Positives = 62/120 (51%), Gaps = 1/120 (0%) Frame = +3 Query: 111 AAAVVSGKDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMP 290 A+ V S I +++P +IRI L S V +E C +++ A+ + GPV +P Sbjct: 73 ASEVPSSSSISVDADKMAPKQKIRIKLRSYWVPLIEDSCKQILDAARNTNAKTMGPVPLP 132 Query: 291 TKILRITTRKTPCGEGSKTWDRFQMRIHKRVID-LHSPSEIVKQITSINIEPGVEVEVTI 467 TK K+P + F++R H+R+ID L+ ++ + + +++ GV+VEV + Sbjct: 133 TKKRIYCVLKSPHVHKDARF-HFEIRTHQRMIDILYPTAQTIDSLMQLDLPAGVDVEVKL 191 >At1g20530.1 68414.m02558 hypothetical protein Length = 614 Score = 29.9 bits (64), Expect = 1.1 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = -3 Query: 390 GRSLSCGFASENDPRSLNLHHKEFYGW*YAGSWLACGLGPLHAASVSW 247 G +C S + P SLNL+H FY Y + P ++ +W Sbjct: 106 GEGTNCDLLSGSKPESLNLNHDSFYSRRYESGTITPPPPPPAPSNYAW 153 >At3g13150.1 68416.m01645 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 551 Score = 27.5 bits (58), Expect = 5.7 Identities = 18/48 (37%), Positives = 25/48 (52%) Frame = +1 Query: 82 ISAGIQQATWQPL*CQAKTSRNPRQRSPLFTASGSLLLLAMCAHSRRS 225 +SAG ++ T P+ AKT+ P SP S LL L++ A S S Sbjct: 406 LSAGKKKTTSSPVSSSAKTTSTPVSSSP--DTSSFLLSLSLAADSSSS 451 >At3g18310.1 68416.m02330 expressed protein Length = 873 Score = 27.1 bits (57), Expect = 7.5 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 242 WSQETEAACKGPSPHANQDPA 304 W+ +++ C GPSP +DP+ Sbjct: 400 WNAQSQMFCFGPSPSVGKDPS 420 >At5g47370.1 68418.m05838 homeobox-leucine zipper protein 2 (HAT2) / HD-ZIP protein 2 identical to homeobox-leucine zipper protein HAT2 (HD-ZIP protein 2) [Arabidopsis thaliana] SP:P46601; contains Pfam profiles PF04618: HD-ZIP protein N terminus, PF02183: Homeobox associated leucine zipper, PF00046: Homeobox domain Length = 283 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -3 Query: 402 RESVGRSLSCGFASENDPRSLNLH 331 +E +G SLS GF+ ++P +NL+ Sbjct: 5 KEDLGLSLSLGFSQNHNPLQMNLN 28 >At5g27220.1 68418.m03247 protein transport protein-related low similarity to SP|P25386 Intracellular protein transport protein USO1 {Saccharomyces cerevisiae} Length = 1181 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -1 Query: 203 IARSKSDPDAVNRGDLCL 150 +A +K DPD+V RG +CL Sbjct: 698 MAVTKLDPDSVRRGSICL 715 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,238,442 Number of Sequences: 28952 Number of extensions: 239460 Number of successful extensions: 547 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 546 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -