BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10b20 (505 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10137| Best HMM Match : No HMM Matches (HMM E-Value=.) 219 8e-58 SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_13751| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_3581| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_57031| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) 28 5.0 SB_28214| Best HMM Match : Drf_FH1 (HMM E-Value=3.8) 28 5.0 SB_36033| Best HMM Match : ATP-synt_B (HMM E-Value=1) 27 6.6 SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) 27 8.8 SB_50021| Best HMM Match : rve (HMM E-Value=0.043) 27 8.8 SB_30037| Best HMM Match : ANATO (HMM E-Value=0.035) 27 8.8 >SB_10137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 219 bits (536), Expect = 8e-58 Identities = 100/132 (75%), Positives = 117/132 (88%) Frame = +1 Query: 76 IRPVYRPTIVKKRTKRFIRHQSDRYDKLKRNWRKPRGIDNRVRRRFKGQYLMPNIGYGSN 255 + PV RP I+KKR K+FIRHQSDRY ++ +WRKP+GIDNRVRRRFKGQYLMPNIGYGSN Sbjct: 2 VMPVNRPRILKKRQKKFIRHQSDRYMRVGESWRKPKGIDNRVRRRFKGQYLMPNIGYGSN 61 Query: 256 KKTRHMLPNGFRKVLVHNVKELEILMMQNRKYCAEIAHGVSSKKRKLIVERAQQLSIRVT 435 KKTR ++P+GF+K +VHNVKELE+LMM NR Y AEIAH VSS+KRK IVERAQQLSI+VT Sbjct: 62 KKTRFLMPDGFKKFVVHNVKELEVLMMMNRSYAAEIAHNVSSRKRKAIVERAQQLSIKVT 121 Query: 436 NAAARLRSQENE 471 N+ ARLRS+ENE Sbjct: 122 NSNARLRSEENE 133 >SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 622 Score = 28.7 bits (61), Expect = 2.9 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 4/80 (5%) Frame = -2 Query: 270 MTGLLVGTVTNV--GHQV--LTLEPPADSVVNTSRFTPIPLKFVIAIRLMPDKSLRPLFD 103 M G + T+T++ H+V L +EP A ++ T++FTP + F+ A + +RP Sbjct: 498 MYGTKLDTITDIIENHKVAILDVEPQALKILRTAKFTPY-VVFISAPSIKGINDIRPPVA 556 Query: 102 DCRPVNRSYSHLVCFFKKRD 43 + P + L K+ D Sbjct: 557 NHEPAEDAGESLKRLAKESD 576 >SB_13751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 853 Score = 28.7 bits (61), Expect = 2.9 Identities = 20/79 (25%), Positives = 36/79 (45%) Frame = +1 Query: 61 TYKMAIRPVYRPTIVKKRTKRFIRHQSDRYDKLKRNWRKPRGIDNRVRRRFKGQYLMPNI 240 +YK++ +P +P + + + SD+ DK+K K + RV KG+ + Sbjct: 14 SYKISAKPKSKPAPLDISAAQAMTSNSDKNDKMKVTTPKSKLGHRRVDE--KGETTYKKV 71 Query: 241 GYGSNKKTRHMLPNGFRKV 297 G S K R +L F ++ Sbjct: 72 GRLSAKPERDVLMQDFAQI 90 >SB_3581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 523 Score = 28.7 bits (61), Expect = 2.9 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +2 Query: 119 RDLSGINRIAMTNLRGIGVNLEVLTTESAGGS 214 +DL I A T+LR +G+N+E+L+ AGGS Sbjct: 169 KDLMAIVFFA-TDLREVGINIELLSMLPAGGS 199 >SB_57031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1495 Score = 28.7 bits (61), Expect = 2.9 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +1 Query: 10 FSCGRVTAWFTVAFLK 57 FSCG V A+FTVAF K Sbjct: 581 FSCGSVVAFFTVAFSK 596 >SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) Length = 291 Score = 27.9 bits (59), Expect = 5.0 Identities = 20/73 (27%), Positives = 39/73 (53%), Gaps = 1/73 (1%) Frame = +1 Query: 256 KKTRHMLPN-GFRKVLVHNVKELEILMMQNRKYCAEIAHGVSSKKRKLIVERAQQLSIRV 432 K+ +H+L N F VLV +++E E Q ++ EIA + ++ +L E ++ L + Sbjct: 93 KQEKHLLYNLEFSPVLVLDLEESEKSAKQEKESDEEIARRLQAEIERLREEGSRLLQEQQ 152 Query: 433 TNAAARLRSQENE 471 A++R +E + Sbjct: 153 ELLKAQIREEEQK 165 >SB_28214| Best HMM Match : Drf_FH1 (HMM E-Value=3.8) Length = 361 Score = 27.9 bits (59), Expect = 5.0 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 429 SDAELLGSFHDQLPLLRRDTMSDLCAVLPVLHH 331 S+ E GSF D++ RRDT S +C +L H Sbjct: 300 SETERGGSFLDEVASPRRDTASPVCLWGAILFH 332 >SB_36033| Best HMM Match : ATP-synt_B (HMM E-Value=1) Length = 550 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 198 SPQAVQGSILDAQHWLRFQQE 260 SP+A+QG ++ AQ W +QE Sbjct: 151 SPEAIQGFLVSAQEWAIHRQE 171 >SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) Length = 784 Score = 27.1 bits (57), Expect = 8.8 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = -2 Query: 456 AEASGRIRHSDAELLGSFHDQLPLLRRDTMSDLCAVLPVLHHQD 325 AEA+ R +ELL S ++LP +RR + + H D Sbjct: 247 AEATNDFRQELSELLASARERLPFMRRSLLEIEATAQEIPTHVD 290 >SB_50021| Best HMM Match : rve (HMM E-Value=0.043) Length = 662 Score = 27.1 bits (57), Expect = 8.8 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = -2 Query: 129 DKSLRPLFDDCRPVNRSYSHLVCFFKKRDSEPRGDTAAREG 7 D++L + D C +H CF KK++ + G +EG Sbjct: 90 DENLHGMIDRCIKTGLKLNHEKCFIKKQEIKFFGVICGKEG 130 >SB_30037| Best HMM Match : ANATO (HMM E-Value=0.035) Length = 124 Score = 27.1 bits (57), Expect = 8.8 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -1 Query: 397 SASASSKRHHERSLRSTSCFASSRFPAL*HCEL 299 S + +R +RS + ++C AS R P+ CEL Sbjct: 21 STEHAYQRRTKRSSKESACCASGRMPSRARCEL 53 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,710,476 Number of Sequences: 59808 Number of extensions: 296123 Number of successful extensions: 1114 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1045 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1113 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1099461690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -