BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10b19 (697 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0382 - 15166553-15166794,15167486-15167730,15168760-15169253 32 0.50 04_03_0346 + 14718686-14719179,14720208-14720452,14721144-14721388 32 0.50 06_03_0757 + 24267599-24268882 29 3.5 10_07_0161 - 13674631-13675433,13675793-13675862 28 8.1 09_02_0336 - 7397745-7398308,7398813-7400723 28 8.1 06_03_0099 + 16633928-16638213,16638299-16638386,16638823-166389... 28 8.1 03_02_0870 + 11964135-11964224,11965013-11965175,11965262-119653... 28 8.1 >04_03_0382 - 15166553-15166794,15167486-15167730,15168760-15169253 Length = 326 Score = 31.9 bits (69), Expect = 0.50 Identities = 17/68 (25%), Positives = 33/68 (48%) Frame = +1 Query: 7 CIKMKRVKCNKVRTVTEIVNSDEKIQKTYELAEFDLKNLSSLESYETLKIKLALSKYMAM 186 CI+ + C +R+ + + E + +TYE+ E LK ++ E + + K +A Sbjct: 230 CIEQVQRACEAMRSCFTDIRTFEILLRTYEVREGGLKGATTNEESNAVPLAQKKRKLLAA 289 Query: 187 LSTLEMTQ 210 TL++ Q Sbjct: 290 AETLDVKQ 297 >04_03_0346 + 14718686-14719179,14720208-14720452,14721144-14721388 Length = 327 Score = 31.9 bits (69), Expect = 0.50 Identities = 17/68 (25%), Positives = 33/68 (48%) Frame = +1 Query: 7 CIKMKRVKCNKVRTVTEIVNSDEKIQKTYELAEFDLKNLSSLESYETLKIKLALSKYMAM 186 CI+ + C +R+ + + E + +TYE+ E LK ++ E + + K +A Sbjct: 230 CIEQVQRACEAMRSCFTDIRTFEILLRTYEVREGGLKGATTNEESNAVPLAQKKRKLLAA 289 Query: 187 LSTLEMTQ 210 TL++ Q Sbjct: 290 AETLDVKQ 297 >06_03_0757 + 24267599-24268882 Length = 427 Score = 29.1 bits (62), Expect = 3.5 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 158 NWRSANTWLCSAPWK*PSRCWK 223 +WR A W+C PW + W+ Sbjct: 348 SWRPAGPWVCFNPWPAQQQAWR 369 >10_07_0161 - 13674631-13675433,13675793-13675862 Length = 290 Score = 27.9 bits (59), Expect = 8.1 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +2 Query: 158 NWRSANTWLCSAPWK*PSRCWK 223 +WR A W+C PW W+ Sbjct: 229 SWRPAGPWVCFNPWPAQQLAWR 250 >09_02_0336 - 7397745-7398308,7398813-7400723 Length = 824 Score = 27.9 bits (59), Expect = 8.1 Identities = 19/72 (26%), Positives = 33/72 (45%) Frame = +1 Query: 13 KMKRVKCNKVRTVTEIVNSDEKIQKTYELAEFDLKNLSSLESYETLKIKLALSKYMAMLS 192 +MK +K N V + EI + K + + FD+K+L ++I +KY LS Sbjct: 616 EMKSMKLNDVWDLEEIPKGAKTETKKFLSSNFDMKDLGEASYVLGIEIHRDRTKYALGLS 675 Query: 193 TLEMTQPLLEIF 228 + +L+ F Sbjct: 676 QKTYIEKVLKKF 687 >06_03_0099 + 16633928-16638213,16638299-16638386,16638823-16638950, 16640008-16640278 Length = 1590 Score = 27.9 bits (59), Expect = 8.1 Identities = 18/55 (32%), Positives = 26/55 (47%) Frame = +1 Query: 466 TEALVNFENDNCNVRIAKTFGASKRKNTTRSDDYESNKQPDYDMDLSDFSITEVE 630 TE N + + N I+K +K+TTR DD + Q M+LS+ T E Sbjct: 525 TEDDANLASSSKNTMISKHHNTVDQKSTTRKDDSRNRSQK--IMELSEVRGTNTE 577 >03_02_0870 + 11964135-11964224,11965013-11965175,11965262-11965380, 11965971-11966083,11966179-11966234,11966320-11966417, 11966588-11966725,11966820-11967125,11967208-11967471, 11967587-11967754,11967838-11968056,11968115-11968158, 11968761-11968830,11968949-11969110,11969672-11969779, 11969873-11969910,11970121-11970265,11970800-11970926, 11971037-11971230,11971529-11971659,11972014-11972089, 11972218-11972328,11972465-11972647,11973264-11973407, 11973946-11973969,11974555-11974728,11974808-11975155, 11975232-11975561,11975776-11975961,11976052-11977026, 11977145-11977399 Length = 1852 Score = 27.9 bits (59), Expect = 8.1 Identities = 17/57 (29%), Positives = 30/57 (52%) Frame = +1 Query: 52 TEIVNSDEKIQKTYELAEFDLKNLSSLESYETLKIKLALSKYMAMLSTLEMTQPLLE 222 TE+ S+++ K E+ E D+ + S + YET ++ + SK LS L +P + Sbjct: 84 TELQLSNDRQSKPDEVTEDDMPSTSGRQLYET-EVPASSSKKHCSLSPLPAYEPAFD 139 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,261,013 Number of Sequences: 37544 Number of extensions: 333889 Number of successful extensions: 943 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 942 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -