BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10b17 (712 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 25 1.8 Y17704-1|CAA76824.2| 401|Anopheles gambiae hypothetical protein... 25 2.3 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 24 4.1 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 7.2 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 7.2 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 25.4 bits (53), Expect = 1.8 Identities = 11/18 (61%), Positives = 13/18 (72%), Gaps = 1/18 (5%) Frame = +1 Query: 277 GNNYHCVLPGGRY-PSSN 327 G NY+CV PG R+ P SN Sbjct: 1110 GINYNCVAPGKRFQPMSN 1127 >Y17704-1|CAA76824.2| 401|Anopheles gambiae hypothetical protein protein. Length = 401 Score = 25.0 bits (52), Expect = 2.3 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = -3 Query: 374 GFRYAAIQSLLSFGHQLLEGYRP--PGKTQW*LFPPVLADQTDIPKQVARQS 225 G R+AAI+ LL + HQ Y P GK P LA +T+ ++ Q+ Sbjct: 301 GHRFAAIEQLLKWAHQ----YAPMRGGKAHLEEILPTLALETEKLRRTVEQT 348 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 24.2 bits (50), Expect = 4.1 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = -3 Query: 641 NLNNIFVKLNKNNTSFIYFSMVQHHMNHEQ 552 NL ++ N N + + +++ HH +H Q Sbjct: 95 NLRSVVANGNANREAGMKINLLNHHQHHHQ 124 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.4 bits (48), Expect = 7.2 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -3 Query: 374 GFRYAAIQSLLSFGHQLLEGY-RPPGKTQW*LFPPVLADQTDIPKQVARQ 228 GFR + LSFGH+ + PG + PV D Q+ RQ Sbjct: 447 GFRVLVEREWLSFGHKFADRCGHGPGSDETNERCPVFLQWLDCVHQIHRQ 496 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.4 bits (48), Expect = 7.2 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -3 Query: 374 GFRYAAIQSLLSFGHQLLEGY-RPPGKTQW*LFPPVLADQTDIPKQVARQ 228 GFR + LSFGH+ + PG + PV D Q+ RQ Sbjct: 447 GFRVLVEREWLSFGHKFADRCGHGPGSDETNERCPVFLQWLDCVHQIHRQ 496 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 714,410 Number of Sequences: 2352 Number of extensions: 14172 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72758970 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -