BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10b17 (712 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81016-6|CAB02667.1| 1573|Caenorhabditis elegans Hypothetical pr... 29 3.3 Z48621-13|CAA88549.1| 1573|Caenorhabditis elegans Hypothetical p... 29 3.3 Z34533-5|CAA84298.1| 781|Caenorhabditis elegans Hypothetical pr... 28 7.6 >Z81016-6|CAB02667.1| 1573|Caenorhabditis elegans Hypothetical protein F21G4.2 protein. Length = 1573 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/42 (35%), Positives = 26/42 (61%) Frame = -3 Query: 443 NKLTFYKRIDLISCFSDQRIEYSGFRYAAIQSLLSFGHQLLE 318 N+L+F ++ DLI ++ +IEYSG +Y + +F L+E Sbjct: 844 NELSFLEKSDLIIVMNEGKIEYSG-KYDDLMQQGAFEQLLIE 884 >Z48621-13|CAA88549.1| 1573|Caenorhabditis elegans Hypothetical protein F21G4.2 protein. Length = 1573 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/42 (35%), Positives = 26/42 (61%) Frame = -3 Query: 443 NKLTFYKRIDLISCFSDQRIEYSGFRYAAIQSLLSFGHQLLE 318 N+L+F ++ DLI ++ +IEYSG +Y + +F L+E Sbjct: 844 NELSFLEKSDLIIVMNEGKIEYSG-KYDDLMQQGAFEQLLIE 884 >Z34533-5|CAA84298.1| 781|Caenorhabditis elegans Hypothetical protein B0285.7 protein. Length = 781 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/42 (26%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +2 Query: 266 PVLVETTTT--AFYQAADILLVIGVQN*ARTEWLHNEIPNIL 385 P+ TTT A+ D++ + +N + EW+H+E+ ++ Sbjct: 371 PLFYNTTTMDGAYLPEIDMIFNLNAKNFKQYEWIHSEVSKVM 412 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,650,464 Number of Sequences: 27780 Number of extensions: 313888 Number of successful extensions: 550 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 550 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1655655746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -