BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10b13 (683 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_21034| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.66 SB_16788| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_15981| Best HMM Match : Defensin_2 (HMM E-Value=1.1) 29 4.6 SB_11728| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_38804| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_34115| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 6.1 SB_4896| Best HMM Match : TFIID_20kDa (HMM E-Value=2.3e-05) 28 6.1 SB_45869| Best HMM Match : ANF_receptor (HMM E-Value=0) 28 8.1 >SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1024 Score = 32.7 bits (71), Expect = 0.28 Identities = 21/68 (30%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = -2 Query: 391 IRTLQLSFSKFTKASVSNSRLSILTIDGLSTEHNSTPSFSVN-KMGSPGMLVSLVSVTTN 215 + L S +F + +NS LT++ L + + T + S +G ++VS+ SVTTN Sbjct: 737 VTPLLFSQERFERFEHNNSLEIKLTVNILQNQGSRTMTSSYYLAIGILSIIVSITSVTTN 796 Query: 214 SILLVKLV 191 S++LV ++ Sbjct: 797 SLILVVII 804 >SB_21034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1101 Score = 31.5 bits (68), Expect = 0.66 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +3 Query: 330 SREFDTEALVNFENDNCNVRIAKTFGASKRKNTTRSDDYESNKQP 464 S E + +ALV +DN N +IAK G+S+ +T +Y K P Sbjct: 183 SVEREIQALVGKSDDNTNKKIAKMDGSSQIPDTLLPSEYHIVKNP 227 >SB_16788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1468 Score = 29.5 bits (63), Expect = 2.7 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = -3 Query: 561 NANRHVRRSATELDIEWLQ-PQLC*NRSNPYR--NLVVYLTRNHRCASCFCA*RRQTSWL 391 N H+ R A ++ + P C R Y+ N +++ ++N +C CA + +W Sbjct: 1305 NCEHHLTRLALKIHRDRKSHPLNCYYRGRMYQTGNKIIHRSKNGKCYRAICAGGKIANWR 1364 Query: 390 SARC 379 SA C Sbjct: 1365 SAVC 1368 >SB_15981| Best HMM Match : Defensin_2 (HMM E-Value=1.1) Length = 890 Score = 28.7 bits (61), Expect = 4.6 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 8/81 (9%) Frame = +3 Query: 21 ETLKIKLALSKYMAMLSTLEMTQPLLEIFRNKADTRQIAAVVF-------STLAFIHNRF 179 +T++ LAL Y E+T LLE+ N+ D + + F S L + RF Sbjct: 753 DTVEQSLALHVYGVEEPGTEITVDLLEVLHNRLDDATLEVISFMLARNPGSKLTYADVRF 812 Query: 180 -HPLVTNFTNKMEFVVTETND 239 PL T+ T + FV+ ++ Sbjct: 813 IQPLGTSPTVTLRFVIPPVDE 833 >SB_11728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 521 Score = 28.7 bits (61), Expect = 4.6 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 8/81 (9%) Frame = +3 Query: 21 ETLKIKLALSKYMAMLSTLEMTQPLLEIFRNKADTRQIAAVVF-------STLAFIHNRF 179 +T++ LAL Y E+T LLE+ N+ D + + F S L + RF Sbjct: 229 DTVEQSLALHVYGVEEPGTEITVDLLEVLHNRLDDATLEVISFMLARNPGSKLTYADVRF 288 Query: 180 -HPLVTNFTNKMEFVVTETND 239 PL T+ T + FV+ ++ Sbjct: 289 IQPLGTSPTVTLRFVIPPVDE 309 >SB_38804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 450 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 595 YCKSLTDHSLFTNKLRSTMSTKTSNLLLS 681 YCK D +LF +K+ T +KTS +L S Sbjct: 188 YCKVEKDLNLFCSKILPTRDSKTSKILTS 216 >SB_34115| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1572 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +3 Query: 225 TETNDTSIPGEPILFTENEGVLLCSVDRPSIVKMLS 332 +E D SI P + N G L+C VDR SI ++ S Sbjct: 37 SELADVSIEPTPHILVGNGG-LMCGVDRESITRVFS 71 >SB_4896| Best HMM Match : TFIID_20kDa (HMM E-Value=2.3e-05) Length = 819 Score = 28.3 bits (60), Expect = 6.1 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 2/72 (2%) Frame = -2 Query: 391 IRTLQLSFSKFT--KASVSNSRLSILTIDGLSTEHNSTPSFSVNKMGSPGMLVSLVSVTT 218 I +++LS S T +S++ ++LS L+ LST STPS S P + V Sbjct: 183 IGSVELSSSAATPSSSSITTTKLSSLSTPSLSTPSLSTPSLSTPLPSKPS---TTWKVFR 239 Query: 217 NSILLVKLVTSG 182 +LL + V G Sbjct: 240 TKVLLERSVKEG 251 >SB_45869| Best HMM Match : ANF_receptor (HMM E-Value=0) Length = 939 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = +3 Query: 405 GASKRKNTTRSDDYESNKQPDYDMDLSDFSITEVEATQYLTLLLIV 542 G SKRK+ TR ++ N + DY + S + +E L ++L + Sbjct: 18 GGSKRKHHTRLKEHTLNSKQDYKLCNSSLVMKSLEWRTVLFIVLCI 63 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,184,782 Number of Sequences: 59808 Number of extensions: 407749 Number of successful extensions: 967 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 904 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 966 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -