BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10b13 (683 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 28 0.072 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 24 1.2 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 23 2.7 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 21 8.3 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 21 8.3 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 21 8.3 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 21 8.3 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 8.3 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 21 8.3 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 28.3 bits (60), Expect = 0.072 Identities = 11/35 (31%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = -2 Query: 316 IDGLSTEHNST-PSFSVNKMGSPGMLVSLVSVTTN 215 +D + EH +T P ++V ++ PG+ ++ + +TTN Sbjct: 408 VDDVFQEHKNTLPQYTVQQLDFPGIEIADIKLTTN 442 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 459 QPDYDMDLSDFSITEVEATQYLTLLLIVE 545 QP D+SD+ + LT+ LIVE Sbjct: 363 QPSEGEDISDYKFRHITEITILTVQLIVE 391 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = +3 Query: 21 ETLKIKLALSKYMAMLSTLEMTQPLLEI 104 + L ++ +++KY+ L +E T+P+L I Sbjct: 96 KNLNLRDSVTKYLIHLKEIEDTEPILLI 123 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = -2 Query: 100 SNSGWVISRVLSIAMYLLSANLIFRV 23 + G +S VLS+++ L+++LIF + Sbjct: 10 AGGGGRLSSVLSLSLTSLASSLIFTI 35 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = -2 Query: 100 SNSGWVISRVLSIAMYLLSANLIFRV 23 + G +S VLS+++ L+++LIF + Sbjct: 10 AGGGGRLSSVLSLSLTSLASSLIFTI 35 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = -2 Query: 100 SNSGWVISRVLSIAMYLLSANLIFRV 23 + G +S VLS+++ L+++LIF + Sbjct: 10 AGGGGRLSSVLSLSLTSLASSLIFTI 35 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = -2 Query: 100 SNSGWVISRVLSIAMYLLSANLIFRV 23 + G +S VLS+++ L+++LIF + Sbjct: 10 AGGGGRLSSVLSLSLTSLASSLIFTI 35 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = +3 Query: 165 IHNRFHPLVTNFTNKMEFVVTETNDTSIPGEPILF 269 + + + +T K+EFVV + P P +F Sbjct: 387 LETEWSSFINPWTKKLEFVVGQHRILKGPANPDIF 421 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = +3 Query: 165 IHNRFHPLVTNFTNKMEFVVTETNDTSIPGEPILF 269 + + + +T K+EFVV + P P +F Sbjct: 93 LETEWSSFINPWTKKLEFVVGQHRILKGPANPDIF 127 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,346 Number of Sequences: 438 Number of extensions: 3775 Number of successful extensions: 13 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -